Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02435
Gene name
Locationscaffold_02:3738866..3739226
Strand+
Gene length (bp)360
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0853 0.0519 0.9516 0.0728 0.1502 0.0145 0.1523 0.1449 0.1648 0.0085

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999762

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup132
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|8119
Ophiocordyceps camponoti-floridani Ophcf2|02435 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4175
Ophiocordyceps kimflemingae Ophio5|7212
Ophiocordyceps kimflemingae Ophio5|7535
Ophiocordyceps kimflemingae Ophio5|7863
Ophiocordyceps subramaniannii Hirsu2|1066
Ophiocordyceps subramaniannii Hirsu2|2840
Ophiocordyceps subramaniannii Hirsu2|5867
Ophiocordyceps subramaniannii Hirsu2|7262
Ophiocordyceps subramaniannii Hirsu2|9763

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02435
MKFTVFALSLAGLISATSAAESSTNAVQAEALDIGSLLGGLKPLLKKGHCVAPCMARSANALDCEDDGPFSTICH
NIDQIHKETLPCAKKCGVDKSLASTVYKIYKDLCKSAMKGSSRE*
Coding >Ophcf2|02435
ATGAAGTTCACCGTCTTCGCCCTCTCCCTCGCCGGCCTCATCAGCGCCACCTCGGCCGCCGAAAGCAGCACGAAC
GCCGTCCAGGCTGAGGCTCTCGACATCGGCTCCCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGGCCACTGC
GTGGCGCCCTGCATGGCGAGGAGCGCGAATGCGCTCGATTGCGAAGACGATGGCCCTTTCTCTACTATTTGCCAC
AACATCGACCAAATCCATAAAGAGACGTTGCCCTGCGCCAAGAAATGCGGCGTTGACAAATCTTTGGCCAGCACC
GTTTACAAGATTTACAAGGACCTCTGCAAGTCGGCTATGAAGGGCAGCAGCAGAGAATAG
Transcript >Ophcf2|02435
ATGAAGTTCACCGTCTTCGCCCTCTCCCTCGCCGGCCTCATCAGCGCCACCTCGGCCGCCGAAAGCAGCACGAAC
GCCGTCCAGGCTGAGGCTCTCGACATCGGCTCCCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGGCCACTGC
GTGGCGCCCTGCATGGCGAGGAGCGCGAATGCGCTCGATTGCGAAGACGATGGCCCTTTCTCTACTATTTGCCAC
AACATCGACCAAATCCATAAAGAGACGTTGCCCTGCGCCAAGAAATGCGGCGTTGACAAATCTTTGGCCAGCACC
GTTTACAAGATTTACAAGGACCTCTGCAAGTCGGCTATGAAGGGCAGCAGCAGAGAATAG
Gene >Ophcf2|02435
ATGAAGTTCACCGTCTTCGCCCTCTCCCTCGCCGGCCTCATCAGCGCCACCTCGGCCGCCGAAAGCAGCACGAAC
GCCGTCCAGGCTGAGGCTCTCGACATCGGCTCCCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGGCCACTGC
GTGGCGCCCTGCATGGCGAGGAGCGCGAATGCGCTCGATTGCGAAGACGATGGCCCTTTCTCTACTATTTGCCAC
AACATCGACCAAATCCATAAAGAGACGTTGCCCTGCGCCAAGAAATGCGGCGTTGACAAATCTTTGGCCAGCACC
GTTTACAAGATTTACAAGGACCTCTGCAAGTCGGCTATGAAGGGCAGCAGCAGAGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail