Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02431
Gene name
Locationscaffold_02:3729181..3731466
Strand-
Gene length (bp)2285
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.0E-158 53 702

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 82 104 22
3 161 183 22
4 187 209 22
5 222 244 22
6 266 288 22
7 301 323 22
8 372 394 22
9 422 444 22
10 449 466 17
11 471 493 22
12 497 514 17
13 535 557 22
14 579 598 19
15 605 627 22
16 642 664 22
17 684 706 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02431
MGQDSPVKTNSSEPEAAVKLDALDEPDSLLEEDSPYEEVRAAVRNSDEGEVANTLRAWLIGLFFVTLGTGLHMFL
SMRSPAISLPAIVVQLLAYPIGCLWARLVPNRVFTIFGRRWSLNPGPFTIKEHVVVSLMSNVSIGGAYSTDALVA
MRARPFFNLDFGWGFALLFTLSSQLVGIALAGLFRHFLVVPAAMIWSRQFASCALFYALHDKRPTPGWRISRFRW
FAAVAAAMFCYSWLPAVVWRGLSVFAFVTWIRPRSPVVNQLFGGFSGLSLLPLTLDWTYVTAYLGDPLLAPTTSH
VNTLVGLLLFVVVACVVMVFTGALHSDYLPVVSANTYDNRQRLYDATRVLGPGQTFDEHRYRRYSPLFLPPALAL
NYGLSFAALTSALVHMWLHQRRDLWHRFRQQQLPDVHAKLMARYVDVPGWWYGALLVLSLGLSLATALGYDSQLP
WWALLVSIALAVLFIIPVTTVLAVYNIMLGLNVLAPFLAGFILPGRPIGVAMFNVYSTVVLLQAQTYSGDLKLGH
YMKVPPRVTFWCQVVATVWAVFVQVAVMNWTLGHVNDVCDDMQPDHFSCPNGRAFFSATVVWGLVGPHRLFGVGG
MYAHLNWFWLLGAALPLLLYGLSRFQAMRSVNRLRAPLMLGAMAWLPPGTPLSYSTWAIVGLIFNGWIRKRWKAW
WMTYNYTTAAALDSGLILATVVVFFAITWPGRELRWWGNADVFDTLDARHAATLKTVPEGGTFGPSAW*
Coding >Ophcf2|02431
ATGGGACAGGATTCGCCTGTCAAGACCAACTCCTCGGAGCCGGAGGCGGCCGTCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCTCTTGGAGGAAGACTCGCCGTACGAAGAGGTGCGAGCCGCTGTGCGCAACTCGGACGAAGGCGAG
GTGGCCAACACGTTGAGGGCATGGCTCATCGGTCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTTCTC
TCCATGAGGAGTCCTGCCATCAGCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTACCCCATCGGCTGCCTCTGG
GCCAGGCTCGTTCCCAACCGCGTCTTTACCATCTTCGGACGGCGCTGGAGCCTCAATCCCGGACCCTTCACCATT
AAGGAGCATGTCGTCGTGTCGCTCATGTCCAATGTCTCCATCGGTGGCGCCTATAGTACCGACGCCCTCGTCGCC
ATGCGCGCCCGACCCTTCTTTAACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCCCAGCTC
GTCGGCATCGCCCTGGCCGGCCTCTTTCGTCACTTCCTCGTCGTGCCGGCCGCCATGATCTGGTCTCGCCAGTTC
GCCAGCTGCGCTCTCTTTTACGCCCTTCACGACAAGAGGCCGACGCCCGGCTGGCGCATCAGCCGCTTTCGCTGG
TTCGCCGCCGTGGCTGCCGCCATGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCCTGTCCGTCTTT
GCCTTTGTCACTTGGATCCGGCCTCGAAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCGCTA
CTCCCCTTGACCCTCGACTGGACCTACGTCACTGCCTACCTCGGCGACCCGCTGCTGGCCCCGACAACGTCGCAC
GTGAACACGCTCGTCGGCCTGCTCCTCTTCGTCGTCGTCGCCTGCGTCGTCATGGTCTTCACGGGAGCCCTGCAC
TCCGACTATCTCCCCGTCGTCTCAGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTGCTG
GGCCCCGGCCAGACGTTTGACGAGCATCGCTATCGCCGCTACTCGCCACTCTTTCTGCCGCCCGCCCTCGCCCTC
AATTACGGCCTGTCGTTTGCCGCTCTGACATCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGACCTCTGG
CACCGCTTCCGCCAGCAGCAGCTGCCCGACGTGCACGCCAAGCTGATGGCACGCTACGTCGACGTCCCCGGCTGG
TGGTACGGTGCACTGCTGGTCTTGTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGATTCGCAGCTGCCG
TGGTGGGCTCTGCTGGTTTCTATCGCCCTCGCTGTTCTCTTCATCATTCCAGTCACGACCGTCTTGGCCGTCTAC
AACATCATGCTCGGCCTCAATGTCCTCGCGCCCTTCCTCGCTGGCTTCATCCTGCCTGGCCGACCCATAGGCGTC
GCCATGTTCAACGTCTACAGTACCGTTGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAACTGGGTCAT
TACATGAAGGTGCCCCCTCGCGTCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAGGTG
GCCGTCATGAACTGGACACTCGGTCACGTCAACGACGTCTGCGATGACATGCAGCCGGACCACTTCTCCTGCCCC
AATGGACGCGCCTTCTTCTCCGCCACCGTCGTCTGGGGCCTCGTCGGTCCGCACCGGCTGTTTGGCGTCGGCGGC
ATGTACGCGCATCTCAACTGGTTCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTATGGTCTCTCTCGGTTC
CAGGCCATGCGGTCCGTGAACCGGCTACGGGCGCCCCTCATGCTGGGTGCCATGGCGTGGCTGCCTCCCGGGACG
CCCCTCAGCTACTCGACGTGGGCCATCGTCGGTCTCATCTTTAACGGCTGGATCCGGAAGAGGTGGAAGGCGTGG
TGGATGACGTACAACTACACAACGGCCGCCGCACTCGACTCGGGCCTGATCCTTGCCACCGTCGTCGTCTTCTTC
GCCATCACTTGGCCGGGACGGGAGCTGCGGTGGTGGGGGAATGCGGACGTCTTTGACACGCTCGATGCCCGGCAC
GCGGCTACCCTCAAGACGGTGCCGGAAGGGGGTACATTTGGGCCTTCAGCGTGGTGA
Transcript >Ophcf2|02431
ATGGGACAGGATTCGCCTGTCAAGACCAACTCCTCGGAGCCGGAGGCGGCCGTCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCTCTTGGAGGAAGACTCGCCGTACGAAGAGGTGCGAGCCGCTGTGCGCAACTCGGACGAAGGCGAG
GTGGCCAACACGTTGAGGGCATGGCTCATCGGTCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTTCTC
TCCATGAGGAGTCCTGCCATCAGCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTACCCCATCGGCTGCCTCTGG
GCCAGGCTCGTTCCCAACCGCGTCTTTACCATCTTCGGACGGCGCTGGAGCCTCAATCCCGGACCCTTCACCATT
AAGGAGCATGTCGTCGTGTCGCTCATGTCCAATGTCTCCATCGGTGGCGCCTATAGTACCGACGCCCTCGTCGCC
ATGCGCGCCCGACCCTTCTTTAACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCCCAGCTC
GTCGGCATCGCCCTGGCCGGCCTCTTTCGTCACTTCCTCGTCGTGCCGGCCGCCATGATCTGGTCTCGCCAGTTC
GCCAGCTGCGCTCTCTTTTACGCCCTTCACGACAAGAGGCCGACGCCCGGCTGGCGCATCAGCCGCTTTCGCTGG
TTCGCCGCCGTGGCTGCCGCCATGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCCTGTCCGTCTTT
GCCTTTGTCACTTGGATCCGGCCTCGAAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCGCTA
CTCCCCTTGACCCTCGACTGGACCTACGTCACTGCCTACCTCGGCGACCCGCTGCTGGCCCCGACAACGTCGCAC
GTGAACACGCTCGTCGGCCTGCTCCTCTTCGTCGTCGTCGCCTGCGTCGTCATGGTCTTCACGGGAGCCCTGCAC
TCCGACTATCTCCCCGTCGTCTCAGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTGCTG
GGCCCCGGCCAGACGTTTGACGAGCATCGCTATCGCCGCTACTCGCCACTCTTTCTGCCGCCCGCCCTCGCCCTC
AATTACGGCCTGTCGTTTGCCGCTCTGACATCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGACCTCTGG
CACCGCTTCCGCCAGCAGCAGCTGCCCGACGTGCACGCCAAGCTGATGGCACGCTACGTCGACGTCCCCGGCTGG
TGGTACGGTGCACTGCTGGTCTTGTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGATTCGCAGCTGCCG
TGGTGGGCTCTGCTGGTTTCTATCGCCCTCGCTGTTCTCTTCATCATTCCAGTCACGACCGTCTTGGCCGTCTAC
AACATCATGCTCGGCCTCAATGTCCTCGCGCCCTTCCTCGCTGGCTTCATCCTGCCTGGCCGACCCATAGGCGTC
GCCATGTTCAACGTCTACAGTACCGTTGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAACTGGGTCAT
TACATGAAGGTGCCCCCTCGCGTCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAGGTG
GCCGTCATGAACTGGACACTCGGTCACGTCAACGACGTCTGCGATGACATGCAGCCGGACCACTTCTCCTGCCCC
AATGGACGCGCCTTCTTCTCCGCCACCGTCGTCTGGGGCCTCGTCGGTCCGCACCGGCTGTTTGGCGTCGGCGGC
ATGTACGCGCATCTCAACTGGTTCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTATGGTCTCTCTCGGTTC
CAGGCCATGCGGTCCGTGAACCGGCTACGGGCGCCCCTCATGCTGGGTGCCATGGCGTGGCTGCCTCCCGGGACG
CCCCTCAGCTACTCGACGTGGGCCATCGTCGGTCTCATCTTTAACGGCTGGATCCGGAAGAGGTGGAAGGCGTGG
TGGATGACGTACAACTACACAACGGCCGCCGCACTCGACTCGGGCCTGATCCTTGCCACCGTCGTCGTCTTCTTC
GCCATCACTTGGCCGGGACGGGAGCTGCGGTGGTGGGGGAATGCGGACGTCTTTGACACGCTCGATGCCCGGCAC
GCGGCTACCCTCAAGACGGTGCCGGAAGGGGGTACATTTGGGCCTTCAGCGTGGTGA
Gene >Ophcf2|02431
ATGGGACAGGATTCGCCTGTCAAGACCAACTCCTCGGAGCCGGAGGCGGCCGTCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCTCTTGGAGGAAGACTCGCCGTACGAAGAGGTGCGAGCCGCTGTGCGCAACTCGGACGAAGGCGAG
GTGGCCAACACGTTGAGGGCATGGCTCATCGGTCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTTCTC
TCCATGAGGTGAGCGTCTCGTCACTGACGGATCAGCCCTGACGCTCATGCTACCTATCCAGGAGTCCTGCCATCA
GCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTACCCCATCGGCTGCCTCTGGGCCAGGCTCGTTCCCAACCGCG
TCTTTACCATCTTCGGACGGCGCTGGAGCCTCAATCCCGGACCCTTCACCATTAAGGAGCATGTCGTCGTGTCGC
TCATGTCCAATGTCTCCATCGGTGGCGCCTATAGTACCGACGCCCTCGTCGCCATGCGCGCCCGACCCTTCTTTA
ACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCCCAGCTCGTCGGCATCGCCCTGGCCGGCC
TCTTTCGTCACTTCCTCGTCGTGCCGGCCGCCATGATCTGGTCTCGCCAGTTCGCCAGCTGCGCTCTCTTTTACG
CCCTTCACGACAAGAGGCCGACGCCCGGCTGGCGCATCAGCCGCTTTCGCTGGTTCGCCGCCGTGGCTGCCGCCA
TGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCCTGTCCGTCTTTGCCTTTGTCACTTGGATCCGGC
CTCGAAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCGCTACTCCCCTTGACCCTCGACTGGA
CCTACGTCACTGCCTACCTCGGCGACCCGCTGCTGGCCCCGACAACGTCGCACGTGAACACGCTCGTCGGCCTGC
TCCTCTTCGTCGTCGTCGCCTGCGTCGTCATGGTCTTCACGGGAGCCCTGCACTCCGACTATCTCCCCGTCGTCT
CAGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTGCTGGGCCCCGGCCAGACGTTTGACG
AGCATCGCTATCGCCGCTACTCGCCACTCTTTCTGCCGCCCGCCCTCGCCCTCAATTACGGCCTGTCGTTTGCCG
CTCTGACATCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGACCTCTGGCACCGCTTCCGCCAGCAGCAGC
TGCCCGACGTGCACGCCAAGCTGATGGCACGCTACGTCGACGTCCCCGGCTGGTGGTACGGTGCACTGCTGGTCT
TGTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGATTCGCAGCTGCCGTGGTGGGCTCTGCTGGTTTCTA
TCGCCCTCGCTGTTCTCTTCATCATTCCAGTCACGACCGTCTTGGCCGTCTACAACATCATGCTCGGCCTCAATG
TCCTCGCGCCCTTCCTCGCTGGCTTCATCCTGCCTGGCCGACCCATAGGCGTCGCCATGTTCAACGTCTACAGTA
CCGTTGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAACTGGGTCATTACATGAAGGTGCCCCCTCGCG
TCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAGGTGGCCGTCATGAACTGGACACTCG
GTCACGTCAACGACGTCTGCGATGACATGCAGCCGGACCACTTCTCCTGCCCCAATGGACGCGCCTTCTTCTCCG
CCACCGTCGTCTGGGGCCTCGTCGGTCCGCACCGGCTGTTTGGCGTCGGCGGCATGTACGCGCATCTCAACTGGT
TCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTATGGTCTCTCTCGGTTCCAGGCCATGCGGTCCGTGAACC
GGCTACGGGCGCCCCTCATGCTGGGTGCCATGGCGTGGCTGCCTCCCGGGACGCCCCTCAGCTACTCGACGTGGG
CCATCGTCGGTCTCATCTTTAACGGCTGGATCCGGAAGAGGTGGAAGGCGTGGTGGATGACGTACAACTACACAA
CGGCCGCCGCACTCGACTCGGGCCTGATCCTTGCCACCGTCGTCGTCTTCTTCGCCATCACTTGGCCGGGACGGG
AGCTGCGGTGGTGGGGGAATGCGGACGTCTTTGACACGCTCGATGCCCGGCACGCGGCTACCCTCAAGACGGTGC
CGGAAGGGGGTACATTTGGGCCTTCAGCGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail