Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02427
Gene name
Locationscaffold_02:3714313..3716047
Strand+
Gene length (bp)1734
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 3.1E-69 130 415
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 5.6E-07 457 513

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016211 ammonia ligase activity No
GO:0016874 ligase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6891 0.5561 0.0442 0.0395 0.3375 0.0425 0.1233 0.0572 0.0576 0.0157

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4757
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6996
Ophiocordyceps australis map64 (Brazil) OphauB2|2792
Ophiocordyceps camponoti-floridani Ophcf2|02427 (this protein)
Ophiocordyceps kimflemingae Ophio5|2808
Ophiocordyceps subramaniannii Hirsu2|1000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02427
MALSPSTAVAPASPPSKLTVDALPELLKHDTRVKLAGLDVDGILRGKLVSKRKFLSVAEAGFGFCSVIFGWDMHD
QTYDRELGVSNAANGYRDMLAVPDLSSYRRIPWEQDVPFFLVSFLDPESRKPICACPRGLLKTQLDRLRDSGCGA
MAGAEYEFFTFKTPESSAAVFVRNQPPDQLQPLTEGMFGYSLTRPVHNQKWYYDVYDACDRFRCDIEGWHTESGP
GVFEAALEFNEAAEMADRASLFKYVVRSVSVQHAVTPCFMAKPRYGLPGNSGHIHVSIVDSSGKNLLASDPDNKK
SCSDGAEYPDVAGLSDLGRHFLAGVLTGLPDVMPMLAPTVNSYKRLVENFWAPVSVSWGLEHRAASIRIISPPTS
KPSATRLEIRVPGADTNPHYALAAILGCGWRGVKAELPLPCPPLSSSSSSSSTSPPSSSSSSSSSSSNNPPGEAT
NGGSGGQQRLAKTLKEATARFVARDSVAREVFGHDFVDHFGGTRENEVRLFDEAVTDWEMKRYLETV*
Coding >Ophcf2|02427
ATGGCCCTCTCTCCGTCCACCGCCGTCGCTCCCGCTTCCCCCCCGTCGAAGCTCACCGTCGACGCCCTGCCCGAG
CTCCTCAAGCACGACACGCGTGTCAAGCTCGCCGGCCTCGACGTCGACGGCATCCTCCGCGGCAAGCTCGTCTCC
AAGCGAAAATTCCTGTCTGTCGCCGAGGCCGGCTTCGGCTTCTGCTCCGTCATCTTCGGCTGGGACATGCACGAC
CAGACCTACGATCGCGAGCTCGGCGTCTCCAACGCGGCAAACGGCTACCGCGACATGCTGGCCGTCCCCGACCTC
TCGTCGTATCGCCGCATCCCCTGGGAGCAAGACGTGCCCTTCTTCCTCGTCAGCTTCCTCGATCCCGAATCCCGG
AAGCCCATATGCGCCTGTCCGCGCGGCCTGCTCAAGACGCAGCTCGACCGCCTGCGCGACAGCGGATGCGGCGCC
ATGGCCGGCGCCGAGTACGAATTCTTCACGTTCAAAACCCCTGAATCTTCGGCGGCCGTCTTCGTGCGGAACCAG
CCGCCGGACCAGCTGCAGCCCCTGACCGAGGGCATGTTTGGCTACTCGCTGACCCGGCCGGTCCACAACCAGAAA
TGGTATTACGACGTCTACGACGCCTGCGACCGCTTCCGCTGCGACATCGAAGGCTGGCACACCGAGTCCGGCCCG
GGCGTCTTCGAAGCCGCCCTCGAGTTCAACGAGGCCGCCGAGATGGCCGACCGCGCCAGCCTCTTCAAGTACGTC
GTCCGCAGCGTCAGCGTCCAACACGCCGTCACCCCCTGCTTCATGGCCAAGCCGCGCTACGGCCTGCCAGGCAAC
AGCGGCCACATCCACGTCTCCATCGTCGACTCCTCCGGCAAGAACCTGCTAGCATCCGACCCCGACAACAAGAAA
TCATGCTCCGACGGCGCCGAGTACCCGGACGTCGCCGGTCTCTCCGACCTCGGCCGCCACTTCCTAGCCGGCGTC
CTGACCGGCCTCCCGGACGTCATGCCCATGCTCGCCCCCACCGTCAACTCGTACAAGCGCCTGGTCGAGAACTTT
TGGGCCCCCGTCTCCGTCTCCTGGGGTCTCGAGCACCGCGCCGCCTCCATCCGCATCATCTCGCCCCCGACATCC
AAGCCCTCGGCCACGCGTCTAGAAATCCGCGTCCCCGGCGCCGACACAAACCCCCATTACGCCCTGGCCGCAATC
CTCGGCTGCGGCTGGCGCGGCGTCAAAGCCGAGCTCCCCCTCCCCTGCCCCCCTTTATCATCGTCGTCGTCATCG
TCCTCCACCTCGCCGCCGTCTTCGTCGTCGTCGTCGTCTTCGTCATCGTCGAATAATCCCCCCGGCGAGGCCACC
AACGGCGGATCAGGAGGCCAGCAGCGCCTAGCCAAGACGCTCAAGGAGGCCACGGCCCGCTTCGTCGCCCGCGAT
AGCGTCGCCCGCGAGGTATTCGGCCATGATTTCGTCGACCATTTTGGCGGCACGAGGGAGAATGAGGTTAGGTTG
TTTGACGAGGCCGTTACCGACTGGGAAATGAAACGCTACCTCGAAACCGTCTAA
Transcript >Ophcf2|02427
ATGGCCCTCTCTCCGTCCACCGCCGTCGCTCCCGCTTCCCCCCCGTCGAAGCTCACCGTCGACGCCCTGCCCGAG
CTCCTCAAGCACGACACGCGTGTCAAGCTCGCCGGCCTCGACGTCGACGGCATCCTCCGCGGCAAGCTCGTCTCC
AAGCGAAAATTCCTGTCTGTCGCCGAGGCCGGCTTCGGCTTCTGCTCCGTCATCTTCGGCTGGGACATGCACGAC
CAGACCTACGATCGCGAGCTCGGCGTCTCCAACGCGGCAAACGGCTACCGCGACATGCTGGCCGTCCCCGACCTC
TCGTCGTATCGCCGCATCCCCTGGGAGCAAGACGTGCCCTTCTTCCTCGTCAGCTTCCTCGATCCCGAATCCCGG
AAGCCCATATGCGCCTGTCCGCGCGGCCTGCTCAAGACGCAGCTCGACCGCCTGCGCGACAGCGGATGCGGCGCC
ATGGCCGGCGCCGAGTACGAATTCTTCACGTTCAAAACCCCTGAATCTTCGGCGGCCGTCTTCGTGCGGAACCAG
CCGCCGGACCAGCTGCAGCCCCTGACCGAGGGCATGTTTGGCTACTCGCTGACCCGGCCGGTCCACAACCAGAAA
TGGTATTACGACGTCTACGACGCCTGCGACCGCTTCCGCTGCGACATCGAAGGCTGGCACACCGAGTCCGGCCCG
GGCGTCTTCGAAGCCGCCCTCGAGTTCAACGAGGCCGCCGAGATGGCCGACCGCGCCAGCCTCTTCAAGTACGTC
GTCCGCAGCGTCAGCGTCCAACACGCCGTCACCCCCTGCTTCATGGCCAAGCCGCGCTACGGCCTGCCAGGCAAC
AGCGGCCACATCCACGTCTCCATCGTCGACTCCTCCGGCAAGAACCTGCTAGCATCCGACCCCGACAACAAGAAA
TCATGCTCCGACGGCGCCGAGTACCCGGACGTCGCCGGTCTCTCCGACCTCGGCCGCCACTTCCTAGCCGGCGTC
CTGACCGGCCTCCCGGACGTCATGCCCATGCTCGCCCCCACCGTCAACTCGTACAAGCGCCTGGTCGAGAACTTT
TGGGCCCCCGTCTCCGTCTCCTGGGGTCTCGAGCACCGCGCCGCCTCCATCCGCATCATCTCGCCCCCGACATCC
AAGCCCTCGGCCACGCGTCTAGAAATCCGCGTCCCCGGCGCCGACACAAACCCCCATTACGCCCTGGCCGCAATC
CTCGGCTGCGGCTGGCGCGGCGTCAAAGCCGAGCTCCCCCTCCCCTGCCCCCCTTTATCATCGTCGTCGTCATCG
TCCTCCACCTCGCCGCCGTCTTCGTCGTCGTCGTCGTCTTCGTCATCGTCGAATAATCCCCCCGGCGAGGCCACC
AACGGCGGATCAGGAGGCCAGCAGCGCCTAGCCAAGACGCTCAAGGAGGCCACGGCCCGCTTCGTCGCCCGCGAT
AGCGTCGCCCGCGAGGTATTCGGCCATGATTTCGTCGACCATTTTGGCGGCACGAGGGAGAATGAGGTTAGGTTG
TTTGACGAGGCCGTTACCGACTGGGAAATGAAACGCTACCTCGAAACCGTCTAA
Gene >Ophcf2|02427
ATGGCCCTCTCTCCGTCCACCGCCGTCGCTCCCGCTTCCCCCCCGTCGAAGCTCACCGTCGACGCCCTGCCCGAG
CTCCTCAAGCACGACACGCGTGTCAAGCTCGCCGGCCTCGACGTCGACGGCATCCTCCGCGGCAAGCTCGTCTCC
AAGCGAAAATTCCTGTCTGTCGCCGAGGCCGGCTTCGGCTTCTGCTCCGTCATCTTCGGCTGGGACATGCACGAC
CAGACCTACGATCGCGAGCTCGGCGTCTCCAACGCGGCAAACGGCTACCGCGACATGCTGGCCGTCCCCGACCTC
TCGTCGTATCGCCGCATCCCCTGGGAGCAAGACGTGCCCTTCTTCCTCGTCAGCTTCCTCGATCCCGAATCCCGG
AAGCCCATATGCGCCTGTCCGCGCGGCCTGCTCAAGACGCAGCTCGACCGCCTGCGCGACAGCGGATGCGGCGCC
ATGGCCGGCGGTGCGTTTTCCGCAGAAGCCTCGTCCCTCTCTCGTCGTCGATTAACCGGCGCTCAGCCGAGTACG
AATTCTTCACGTTCAAAACCCCTGAATCTTCGGCGGCCGTCTTCGTGCGGAACCAGCCGCCGGACCAGCTGCAGC
CCCTGACCGAGGGCATGTTTGGCTACTCGCTGACCCGGCCGGTCCACAACCAGAAATGGTATTACGACGTCTACG
ACGCCTGCGACCGCTTCCGCTGCGACATCGAAGGCTGGCACACCGAGTCCGGCCCGGGCGTCTTCGAAGCCGCCC
TCGAGTTCAACGAGGCCGCCGAGATGGCCGACCGCGCCAGCCTCTTCAAGTACGTCGTCCGCAGCGTCAGCGTCC
AACACGCCGTCACCCCCTGCTTCATGGCCAAGCCGCGCTACGGCCTGCCAGGCAACAGCGGCCACATCCACGTCT
CCATCGTCGACTCCTCCGGCAAGAACCTGCTAGCATCCGACCCCGACAACAAGAAATCATGCTCCGACGGCGCCG
AGTACCCGGACGTCGCCGGTCTCTCCGACCTCGGCCGCCACTTCCTAGCCGGCGTCCTGACCGGCCTCCCGGACG
TCATGCCCATGCTCGCCCCCACCGTCAACTCGTACAAGCGCCTGGTCGAGAACTTTTGGGCCCCCGTCTCCGTCT
CCTGGGGTCTCGAGCACCGCGCCGCCTCCATCCGCATCATCTCGCCCCCGACATCCAAGCCCTCGGCCACGCGTC
TAGAAATCCGCGTCCCCGGCGCCGACACAAACCCCCATTACGCCCTGGCCGCAATCCTCGGCTGCGGCTGGCGCG
GCGTCAAAGCCGAGCTCCCCCTCCCCTGCCCCCCTTTATCATCGTCGTCGTCATCGTCCTCCACCTCGCCGCCGT
CTTCGTCGTCGTCGTCGTCTTCGTCATCGTCGAATAATCCCCCCGGCGAGGCCACCAACGGCGGATCAGGAGGCC
AGCAGCGCCTAGCCAAGACGCTCAAGGAGGCCACGGCCCGCTTCGTCGCCCGCGATAGCGTCGCCCGCGAGGTAT
TCGGCCATGATTTCGTCGACCATTTTGGCGGCACGAGGGAGAATGAGGTTAGGTTGTTTGACGAGGCCGTTACCG
ACTGGTCAGTGTTCACTTTTCTTACTTCTCTTTCTCTCTCTCTCTCTCTTTCTCTCTTTTTCTCTCTTTTTCTCA
CCCTCTCTCTCCCCCCTCTCACCATCTCACCCCCCAAAACTAACCCTCAACAGGGAAATGAAACGCTACCTCGAA
ACCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail