Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02416
Gene name
Locationscaffold_02:3687831..3692002
Strand+
Gene length (bp)4171
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 4.0E-143 280 763
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 9.7E-57 29 274
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 1.1E-41 797 930

GO

GO Term Description Terminal node
GO:0006801 superoxide metabolic process Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0072593 reactive oxygen species metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1925 0.0599 0.9198 0.0833 0.1237 0.0544 0.3731 0.3114 0.1828 0.0077

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999591

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH92 3.0E-157 255 764

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup397
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6011
Ophiocordyceps australis 1348a (Ghana) OphauG2|6012
Ophiocordyceps australis map64 (Brazil) OphauB2|1816
Ophiocordyceps camponoti-floridani Ophcf2|02416 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6759
Ophiocordyceps kimflemingae Ophio5|2818
Ophiocordyceps subramaniannii Hirsu2|1943
Ophiocordyceps subramaniannii Hirsu2|9870

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02416
MASRRLLQVLISLGAAAAQAPPGFDALDLVDPLIGTVNGGNVFPGATVPYGMAKAVADSAEANQGGFAYDGRPVT
GFSVMHDSGTGGSPSLGLFALFPYASCPADDVNGCEFPKKSRLRFGGYATETVEARPGYFGLGLGAGPRVEMTAT
EHAALFRFTFRPGDRPLILQDLTDLSDSRQDNGTVKVDVTGRRITGDAVFVPSFGQGRYRAYFCTDFGPGRSIVD
GGIFVDNRASVNVSELVISRGINGYPLPGGAWMHFADGREPVVARVGVSLISSRQACASAEAEMPDWDFEGVASA
AADRWRRKLESVAVDATGVDAGLVRSLYSGVYRTMISPQNYTGENPLWREEGVPYFDSFYCIWDLFRSQLPLLTI
IDPQALSQMIRSLISVYEHDGWMPDCRMSLNRGYTQGGSNADNVLADAFVKGIRQGIDWEKGLEAAKKDADVEPF
DWSSHGRGGLDSWKALGYIPVSDFDHRGFGTHTRSVSRTLEYSYNDFCVGQLAGGLNRIADAEKYRASSGNWRNL
WRADQGSRLANGSDTGFTGFFQPRHLNETWASQDPLRCSPIDHSGSECSLTAGAGETFEGSLWEYGFFVPHAQAE
LIKLCGGPDAFVRRLTYLHDNGINDIGNEPAFLTVFQYHYAGRPALSAQRVHSLIPSRFSDSPSGLPGNDDSGAM
GAFVFFCMIGLFPNPGQNVYLIAPPFFPSVNVTSPLTGKTAIVRVVNFDARYRNVFIQSATLNGEKYTRNWIHHS
FFTEGKELVLTLGERESDWGTAVEDLPPSMGTYAENAGGSVFRGMAVGTITFQQHRDHVHVSGTLRGLTPGLHGF
HVHEKGDTSQMCAGAGPHFNPFKQNHGAPSDQVRHVGDLGNIKANEEGVAYVSIYDSKISLVDPTRNILNRAIVV
HADRDDLGRGGQKESLTTGNSGSRVGCGVIVVDQSGYGRNQGNGGEYGQGQSYGQRQVYDQNKGYGQDQTYEKSK
GY*
Coding >Ophcf2|02416
ATGGCCTCCCGCCGGCTGCTGCAAGTGCTCATCTCCCTCGGCGCCGCGGCCGCTCAGGCCCCCCCCGGCTTCGAT
GCGCTCGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTCCCGGAGCGACGGTACCGTAC
GGAATGGCCAAGGCCGTTGCCGACTCGGCCGAGGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTGACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGTTCACCTTCTCTCGGCCTCTTTGCCCTCTTCCCCTACGCT
TCATGTCCGGCCGATGACGTCAATGGCTGCGAGTTTCCCAAGAAGAGCCGGCTTCGCTTCGGCGGTTATGCCACC
GAGACGGTAGAGGCCCGGCCCGGGTATTTCGGCCTTGGCCTCGGGGCCGGGCCGCGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTTCGATTTACTTTCCGACCGGGAGATAGGCCGTTGATTCTCCAGGACCTGACGGACCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGCGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGGTACCGTGCCTATTTCTGTACCGACTTCGGACCCGGACGGAGCATCGTCGAC
GGCGGCATCTTCGTCGATAACCGTGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGTTAT
CCGCTTCCCGGAGGCGCCTGGATGCACTTCGCCGACGGCCGAGAGCCCGTCGTGGCCCGCGTAGGCGTCAGTCTC
ATAAGCTCTCGGCAGGCCTGTGCCAGTGCCGAGGCCGAGATGCCGGACTGGGACTTTGAAGGCGTCGCCTCGGCC
GCTGCCGATAGGTGGAGGCGCAAGCTGGAGTCGGTGGCCGTGGACGCGACCGGCGTCGACGCGGGTCTCGTTCGG
AGTCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCGGGAA
GAGGGCGTTCCTTACTTCGACTCCTTCTACTGCATCTGGGATCTCTTCCGCTCTCAACTGCCGCTACTGACCATC
ATCGATCCTCAAGCGCTTTCGCAGATGATCCGCTCGCTCATTTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGTGGCTACACCCAGGGCGGCTCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCGTCAGGGCATCGACTGGGAAAAGGGGCTCGAGGCAGCCAAGAAGGACGCCGACGTCGAGCCCTTC
GACTGGTCTTCTCACGGCCGTGGGGGGCTCGACTCGTGGAAGGCCCTGGGGTACATCCCCGTGTCCGACTTTGAC
CACCGCGGCTTCGGCACTCATACCCGCAGCGTGAGCCGGACGCTGGAGTATAGCTATAACGACTTTTGCGTCGGA
CAGCTGGCCGGGGGTCTGAACCGGATCGCCGACGCGGAGAAGTATCGGGCCTCGAGCGGCAACTGGCGTAACCTC
TGGCGCGCGGATCAGGGCTCGAGGCTGGCCAACGGGTCTGATACGGGCTTCACCGGCTTCTTCCAGCCTCGTCAT
CTCAACGAGACGTGGGCATCGCAGGATCCGCTACGGTGTAGTCCCATCGATCACTCGGGGAGCGAATGCTCGCTG
ACGGCCGGCGCGGGCGAGACGTTCGAGGGCAGTCTTTGGGAGTACGGCTTCTTCGTGCCTCACGCCCAGGCGGAA
CTCATCAAGCTCTGCGGCGGTCCGGATGCCTTCGTCCGACGGCTGACGTACCTCCACGACAATGGCATCAACGAC
ATCGGCAACGAGCCCGCCTTCCTGACCGTCTTTCAGTATCATTACGCCGGCAGGCCTGCCCTCTCGGCCCAGCGC
GTCCACTCGCTGATCCCGAGCCGCTTCTCCGACTCGCCTTCGGGTCTGCCTGGCAACGACGATAGCGGTGCCATG
GGGGCCTTTGTCTTTTTCTGCATGATTGGACTGTTTCCGAATCCGGGGCAGAACGTCTATCTGATTGCTCCGCCC
TTTTTCCCCAGCGTCAACGTCACGAGTCCGTTGACGGGTAAGACGGCCATTGTGCGCGTCGTCAATTTTGACGCT
CGCTATCGTAACGTTTTTATTCAATCGGCTACCCTCAATGGAGAGAAGTATACCAGGAATTGGATCCATCACTCG
TTCTTTACTGAGGGGAAAGAGCTTGTCTTGACGCTGGGTGAGAGAGAGAGTGACTGGGGGACTGCGGTTGAGGAT
CTGCCGCCCAGCATGGGGACTTATGCTGAGAATGCAGGGGGGAGCGTTTTTCGCGGCATGGCCGTGGGGACGATT
ACTTTTCAGCAGCACCGAGATCACGTTCACGTCTCGGGAACGCTCCGCGGCTTGACTCCCGGTCTTCATGGCTTC
CACGTCCACGAGAAGGGAGACACTAGCCAGATGTGCGCCGGCGCCGGACCTCACTTCAACCCGTTTAAGCAGAAC
CACGGAGCACCGAGCGATCAGGTCCGCCATGTGGGCGATCTCGGAAACATCAAGGCTAATGAAGAGGGCGTCGCC
TACGTGTCCATATACGACTCCAAGATCTCGCTGGTCGATCCCACGAGGAATATTCTAAACCGTGCCATCGTCGTC
CACGCTGACCGGGACGATCTTGGACGCGGTGGACAGAAAGAGTCGTTGACGACGGGGAATTCCGGCTCGAGAGTT
GGATGCGGCGTCATCGTCGTCGACCAGAGCGGATACGGCCGAAATCAGGGAAATGGTGGAGAATACGGCCAAGGC
CAGAGTTACGGTCAGAGGCAGGTATATGATCAGAACAAGGGCTACGGACAGGACCAGACGTATGAGAAAAGCAAG
GGGTATTGA
Transcript >Ophcf2|02416
ATGGCCTCCCGCCGGCTGCTGCAAGTGCTCATCTCCCTCGGCGCCGCGGCCGCTCAGGCCCCCCCCGGCTTCGAT
GCGCTCGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTCCCGGAGCGACGGTACCGTAC
GGAATGGCCAAGGCCGTTGCCGACTCGGCCGAGGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTGACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGTTCACCTTCTCTCGGCCTCTTTGCCCTCTTCCCCTACGCT
TCATGTCCGGCCGATGACGTCAATGGCTGCGAGTTTCCCAAGAAGAGCCGGCTTCGCTTCGGCGGTTATGCCACC
GAGACGGTAGAGGCCCGGCCCGGGTATTTCGGCCTTGGCCTCGGGGCCGGGCCGCGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTTCGATTTACTTTCCGACCGGGAGATAGGCCGTTGATTCTCCAGGACCTGACGGACCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGCGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGGTACCGTGCCTATTTCTGTACCGACTTCGGACCCGGACGGAGCATCGTCGAC
GGCGGCATCTTCGTCGATAACCGTGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGTTAT
CCGCTTCCCGGAGGCGCCTGGATGCACTTCGCCGACGGCCGAGAGCCCGTCGTGGCCCGCGTAGGCGTCAGTCTC
ATAAGCTCTCGGCAGGCCTGTGCCAGTGCCGAGGCCGAGATGCCGGACTGGGACTTTGAAGGCGTCGCCTCGGCC
GCTGCCGATAGGTGGAGGCGCAAGCTGGAGTCGGTGGCCGTGGACGCGACCGGCGTCGACGCGGGTCTCGTTCGG
AGTCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCGGGAA
GAGGGCGTTCCTTACTTCGACTCCTTCTACTGCATCTGGGATCTCTTCCGCTCTCAACTGCCGCTACTGACCATC
ATCGATCCTCAAGCGCTTTCGCAGATGATCCGCTCGCTCATTTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGTGGCTACACCCAGGGCGGCTCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCGTCAGGGCATCGACTGGGAAAAGGGGCTCGAGGCAGCCAAGAAGGACGCCGACGTCGAGCCCTTC
GACTGGTCTTCTCACGGCCGTGGGGGGCTCGACTCGTGGAAGGCCCTGGGGTACATCCCCGTGTCCGACTTTGAC
CACCGCGGCTTCGGCACTCATACCCGCAGCGTGAGCCGGACGCTGGAGTATAGCTATAACGACTTTTGCGTCGGA
CAGCTGGCCGGGGGTCTGAACCGGATCGCCGACGCGGAGAAGTATCGGGCCTCGAGCGGCAACTGGCGTAACCTC
TGGCGCGCGGATCAGGGCTCGAGGCTGGCCAACGGGTCTGATACGGGCTTCACCGGCTTCTTCCAGCCTCGTCAT
CTCAACGAGACGTGGGCATCGCAGGATCCGCTACGGTGTAGTCCCATCGATCACTCGGGGAGCGAATGCTCGCTG
ACGGCCGGCGCGGGCGAGACGTTCGAGGGCAGTCTTTGGGAGTACGGCTTCTTCGTGCCTCACGCCCAGGCGGAA
CTCATCAAGCTCTGCGGCGGTCCGGATGCCTTCGTCCGACGGCTGACGTACCTCCACGACAATGGCATCAACGAC
ATCGGCAACGAGCCCGCCTTCCTGACCGTCTTTCAGTATCATTACGCCGGCAGGCCTGCCCTCTCGGCCCAGCGC
GTCCACTCGCTGATCCCGAGCCGCTTCTCCGACTCGCCTTCGGGTCTGCCTGGCAACGACGATAGCGGTGCCATG
GGGGCCTTTGTCTTTTTCTGCATGATTGGACTGTTTCCGAATCCGGGGCAGAACGTCTATCTGATTGCTCCGCCC
TTTTTCCCCAGCGTCAACGTCACGAGTCCGTTGACGGGTAAGACGGCCATTGTGCGCGTCGTCAATTTTGACGCT
CGCTATCGTAACGTTTTTATTCAATCGGCTACCCTCAATGGAGAGAAGTATACCAGGAATTGGATCCATCACTCG
TTCTTTACTGAGGGGAAAGAGCTTGTCTTGACGCTGGGTGAGAGAGAGAGTGACTGGGGGACTGCGGTTGAGGAT
CTGCCGCCCAGCATGGGGACTTATGCTGAGAATGCAGGGGGGAGCGTTTTTCGCGGCATGGCCGTGGGGACGATT
ACTTTTCAGCAGCACCGAGATCACGTTCACGTCTCGGGAACGCTCCGCGGCTTGACTCCCGGTCTTCATGGCTTC
CACGTCCACGAGAAGGGAGACACTAGCCAGATGTGCGCCGGCGCCGGACCTCACTTCAACCCGTTTAAGCAGAAC
CACGGAGCACCGAGCGATCAGGTCCGCCATGTGGGCGATCTCGGAAACATCAAGGCTAATGAAGAGGGCGTCGCC
TACGTGTCCATATACGACTCCAAGATCTCGCTGGTCGATCCCACGAGGAATATTCTAAACCGTGCCATCGTCGTC
CACGCTGACCGGGACGATCTTGGACGCGGTGGACAGAAAGAGTCGTTGACGACGGGGAATTCCGGCTCGAGAGTT
GGATGCGGCGTCATCGTCGTCGACCAGAGCGGATACGGCCGAAATCAGGGAAATGGTGGAGAATACGGCCAAGGC
CAGAGTTACGGTCAGAGGCAGGTATATGATCAGAACAAGGGCTACGGACAGGACCAGACGTATGAGAAAAGCAAG
GGGTATTGA
Gene >Ophcf2|02416
ATGGCCTCCCGCCGGCTGCTGCAAGTGCTCATCTCCCTCGGCGCCGCGGCCGCTCAGGCCCCCCCCGGCTTCGAT
GCGCTCGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTCCCGGAGCGACGGTACCGTAC
GGAATGGCCAAGGCCGTTGCCGACTCGGCCGAGGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTGACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGTTCACCTTCTCTCGGCCTCTTTGCCCTCTTCCCCTACGCT
TCATGTCCGGCCGATGACGTCAATGGCTGCGAGTTTCCCAAGAAGAGCCGGCTTCGCTTCGGCGGTTATGCCACC
GAGACGGTAGAGGCCCGGCCCGGGTATTTCGGCCTTGGCCTCGGGGCCGGGCCGCGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTTCGATTTACTTTCCGACCGGGAGATAGGCCGTTGATTCTCCAGGACCTGACGGACCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGCGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGGTACCGTGCCTATTTCTGTACCGACTTCGGACCCGGACGGAGCATCGTCGAC
GGCGGCATCTTCGTCGATAACCGTGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGTTAT
CCGCTTCCCGGAGGCGCCTGGATGCACTTCGCCGACGGCCGAGAGCCCGTCGTGGCCCGCGTAGGCGTCAGTCTC
ATAAGCTCTCGGCAGGCCTGTGCCAGTGCCGAGGCCGAGATGCCGGACTGGGACTTTGAAGGCGTCGCCTCGGCC
GCTGCCGATAGGTGGAGGCGCAAGCTGGAGTCGGTGGCCGTGGACGCGACCGGCGTCGACGCGGGTCTCGTTCGG
AGTCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCGGGAA
GAGGGCGTTCCTTACTTCGACTCCTTCTACTGCATCTGGGATCTCTTCCGCTCTCAACTGCCGCTACTGACCATC
ATCGATCCTCAAGCGCTTTCGCAGATGATCCGCTCGCTCATTTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGTGGCTACACCCAGGGCGGCTCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCGTCAGGGCATCGACTGGGAAAAGGGGCTCGAGGCAGCCAAGAAGGACGCCGACGTCGAGCCCTTC
GACTGGTCTTCTCACGGCCGTGGGGGGCTCGACTCGTGGAAGGCCCTGGGGTACATCCCCGTGTCCGACTTTGAC
CACCGCGGCTTCGGCACTCATACCCGCAGCGTGAGCCGGACGCTGGAGTATAGCTATAACGACTTTTGCGTCGGA
CAGCTGGCCGGGGGTCTGAACCGGATCGCCGACGCGGAGAAGTATCGGGCCTCGAGCGGCAACTGGCGTAACCTC
TGGCGCGCGGATCAGGGCTCGAGGCTGGCCAACGGGTCTGATACGGGCTTCACCGGCTTCTTCCAGCCTCGTCAT
CTCAACGAGACGTGGGCATCGCAGGATCCGCTACGGTGTAGTCCCATCGATCACTCGGGGAGCGAATGCTCGCTG
ACGGCCGGCGCGGGCGAGACGTTCGAGGGCAGTCTTTGGGAGTACGGCTTGTGAGTCTTCCGTAGTCTTCCGTCC
CCGGGGAGTTACACGTCGACCGCGATGTGACTCTGGTGACCTCTCTGACGCCCATGGACACAGCTTCGTGCCTCA
CGCCCAGGCGGAACTCATCAAGCTCTGCGGCGGTCCGGATGCCTTCGTCCGACGGCTGACGTACCTCCACGACAA
TGGCATCAACGACATCGGCAACGAGCCCGCCTTCCTGACCGTCTTTCAGTATCATTACGCCGGCAGGCCTGCCCT
CTCGGCCCAGCGCGTCCACTCGCTGATCCCGAGCCGCTTCTCCGACTCGCCTTCGGGTCTGCCTGGCAACGACGA
TAGCGGTGCCATGGGGGCCTTTGTCTTTTTCTGCATGATTGGACTGTTTCCGAATCCGGGGCAGAACGTCTATCT
GATTGCTCCGCCCTTTTTCCCCAGCGTCAACGTCACGAGTCCGTTGACGGGTAAGACGGCCATTGTGCGCGTCGT
CAATTTTGACGCTCGCTATCGTAACGTTTTTATTCAATCGGCTACCCTCAATGGAGAGAAGTATACCAGGAATTG
GATCCATCACTCGTTCTTTACTGAGGGGAAAGAGCTTGTCTTGACGCTGGGTGAGAGAGAGAGTGACTGGGGGAC
TGCGGTTGAGGATCTGCCGCCCAGCATGGGGACTTATGCTGAGAATGCAGGGGGGAGGTGAAGGGGAGGGAGCTT
TCGTTCCCCGGGTGGCTCGTCATTGTCGGAACCAGGCCGTCGGACGGATAGCTCCGAGTGTCTAGCACAGCGAAC
GGTCATAGAAGATGCGTGTGTGACTCATTATAATAATTCATCATTAGTTAGTCCTTCAAGCTCTCTTACCCGCAA
CGAGGCTGACCGTCTAAAACACAGCCCCCATCTCCGCGAGAAGTCGTGACGCACGAGCCCGTTCCTGACGGTAGA
TGGCCTTGCTAGAAGCCGAGGTTGGTTGCGTACGTGCATGCCAGTCTGCGGCCCTGCCAGCCTCGCAACTACCGC
ATCGCCGGCGTGAGACGGAAAGCGCGAGGTTGGCCTCTTGTGCGGAATGATCAAGATTCCCGTCTCGGATTTGGC
ATCGCGAGTTGAAGGTTGGATCTTTGACGCTGATGGGCCGTTGCTGCGTCTACCTCGGGTGTAAACCCCGATGTT
ATTACCAGACTCCATCTTTACTATGTATTTCCGTTCGTCAGATACATCATACGTCAGTGTGAGAAAGGGCCTATG
GTATTGTTATTGCCCGCCCGGGAATAGCCCCAGATGCTGAAGTCAAACCCGACTTCAACCGCTCTCTCTTCGTAT
GTATGCACGTACTGCGCCATGCTCGTCACCGTGATGTGTCTGAGTCGTCACATAACTAGCCATCTCACTCCTACT
AAGCGCTAAGCTACCATATGTACGAATGCTCAACGGCATCATCATGACGGACGACTTTATAACCCTCCTCGTCTC
CTACATATACAGTATGAAACTAGCCGTACCGCATCAGGCATCTGCCTCTATACCCTCTCAAATCAGCTCACACCC
TCTCGCCGAGCTCTGATAGTTGAAGCCCGCCGAAATCTTCTCAAAAAAAAAAAAGAAAAATGGTCAACGCAAGTA
TGTACATGATGAAACCTGCGCCGTCCAGTCTTCTTCCAGCATCTGATGCAGTCTAGTCAGCGTTTTTCGCGGCAT
GGCCGTGGGGACGATTACTTTTCAGCAGCACCGAGATCACGTTCACGTCTCGGGAACGCTCCGCGGCTTGACTCC
CGGTCTTCATGGCTTCCACGTCCACGAGAAGGGAGACACTAGCCAGATGTGCGCCGGCGCCGGACCTCACTGTGA
GTGAAGTCGTGGTTGGGTTTGAAGGACTGCTGGCTGACTGCCGTTTCACGCAGTCAACCCGTTTAAGCAGAACCA
CGGAGCACCGAGCGATCAGGTCCGCCATGTGGGCGATCTCGGAAACATCAAGGCTAATGAAGAGGGCGTCGCCTA
CGTGTCCATATACGACTCCAAGATCTCGCTGGTCGATCCCACGAGGAATATTCTAAACGTACGTGTTTCGACAAG
GGCATGCCGGGGCGATATGGCAGGACTAACTCTTTACAAAGCGTGCCATCGTCGTCCACGCTGACCGGGACGATC
TTGGACGCGGTGGACAGAAAGAGTCGTTGACGACGGGGAATTCCGGCTCGAGAGTTGGATGCGGTAGGTCTTGAG
TCTCGGTATCCCAGCTTAGGACTGAGCTGACTGACTGAAATAAGGCGTCATCGTCGTCGACCAGAGCGGATACGG
CCGAAATCAGGGAAATGGTGGAGAATACGGCCAAGGCCAGAGTTACGGTCAGAGGCAGGTATATGATCAGAACAA
GGGCTACGGACAGGACCAGACGTATGAGAAAAGCAAGGGGTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail