Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02415
Gene name
Locationscaffold_02:3684974..3686611
Strand-
Gene length (bp)1637
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.2E-69 41 470

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1033 0.0695 0.1482 0.1123 0.1238 0.0283 0.8325 0.2524 0.4585 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1376
Ophiocordyceps australis 1348a (Ghana) OphauG2|5000
Ophiocordyceps australis map64 (Brazil) OphauB2|2330
Ophiocordyceps australis map64 (Brazil) OphauB2|6638
Ophiocordyceps camponoti-floridani Ophcf2|02415 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05427
Ophiocordyceps camponoti-floridani Ophcf2|05428
Ophiocordyceps camponoti-rufipedis Ophun1|2176
Ophiocordyceps camponoti-rufipedis Ophun1|6758
Ophiocordyceps kimflemingae Ophio5|1176
Ophiocordyceps kimflemingae Ophio5|1177
Ophiocordyceps kimflemingae Ophio5|4504
Ophiocordyceps subramaniannii Hirsu2|6059
Ophiocordyceps subramaniannii Hirsu2|667
Ophiocordyceps subramaniannii Hirsu2|826
Ophiocordyceps subramaniannii Hirsu2|9048

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02415
MSFVYLIACAFALAITRSIIQVLRSSTSRLPGPWYTKWTSLVLDFHWMTASRTGYVHRLHQLYGPIVRLAPNEVA
VSDMEAVKTIYSTKETYRKSDFYRRVVTVGTESLFSTVDVDFHRRHRRMLAGPMSESSIKNMAPRVEARVQLAIS
RIADEMKQRGSADVCKWWLFLATDVIGELTFGDSFRMLELGKVSLPIFPVGSLIQDAHMHLSRQKNDYARELEDV
NRLTAIRSTFPSIVRFCRIVPLPVFKRAHEASINLRSYARDSLLRYRRLVENDPNVAQETLFTKLFRAETDEKLP
FDELLSEAQSYIVAGSDTTANTLTYLTWSICRNPDIRSKLVQELRTLPPDFEDAQLHDLPYLNNVINESLRLYSA
APNGLPRVVPPGGAELAGYRFDADTVVSAQAYSMHRDPVVFPNPDSFLPERWAEPTKAMKDAFMAFGRGPRVCIG
QHLARMELRLATARFFLTFPEARPSSQWGMSDDDMKPRIHFLLTPSGGRCLIQP*
Coding >Ophcf2|02415
ATGTCCTTCGTCTACCTCATCGCCTGCGCCTTTGCGCTCGCCATCACCCGCTCCATCATCCAGGTCCTCCGCTCA
TCCACTTCCCGCCTCCCGGGTCCGTGGTATACCAAATGGACCAGCCTCGTCCTCGACTTCCACTGGATGACGGCC
TCTCGAACGGGCTACGTTCACCGCCTACACCAGCTCTACGGCCCCATCGTCCGCCTCGCGCCCAACGAAGTAGCC
GTCTCGGACATGGAAGCCGTAAAGACCATCTACAGCACAAAGGAAACCTACCGCAAGTCCGACTTCTACCGCCGT
GTCGTCACCGTCGGCACCGAGTCGCTCTTCTCCACCGTCGACGTCGACTTTCACCGGAGGCATCGGAGGATGCTC
GCCGGTCCCATGTCCGAGTCCTCCATCAAGAACATGGCGCCTAGAGTCGAGGCTCGTGTCCAACTGGCCATCAGC
CGTATCGCAGACGAGATGAAACAGCGCGGATCGGCCGACGTCTGCAAGTGGTGGCTCTTCCTGGCGACTGATGTC
ATTGGGGAGCTCACTTTTGGCGACTCGTTCCGCATGCTGGAGCTCGGCAAGGTCAGTTTACCCATCTTTCCCGTC
GGCTCTTTGATCCAAGATGCTCACATGCACTTGTCACGACAGAAGAACGACTACGCTCGTGAGCTCGAGGACGTA
AATCGTCTAACCGCCATCCGCTCAACCTTCCCATCCATCGTCCGCTTCTGCCGCATCGTTCCCCTACCCGTCTTT
AAACGAGCGCACGAAGCCTCCATCAACCTTCGCAGTTACGCCCGCGACTCTCTCCTTCGCTACCGTCGCCTCGTC
GAAAACGACCCCAACGTCGCGCAGGAAACGCTCTTCACCAAGCTCTTTCGGGCCGAGACGGATGAGAAGCTCCCC
TTCGACGAGCTGCTTAGCGAGGCTCAGTCGTACATCGTTGCTGGCAGCGATACCACCGCCAATACACTCACCTAC
CTCACCTGGTCCATCTGTCGAAACCCCGACATCCGTTCTAAACTGGTCCAAGAGCTGCGGACCCTGCCGCCCGAC
TTTGAGGATGCTCAGCTGCACGACCTGCCCTATCTCAACAACGTCATCAATGAGTCGCTCCGCCTCTACTCGGCC
GCTCCCAACGGTCTGCCTCGTGTCGTGCCTCCGGGCGGCGCCGAGCTCGCCGGTTACCGCTTCGACGCCGATACC
GTCGTCAGCGCCCAGGCCTATAGCATGCACCGCGATCCCGTCGTCTTCCCCAACCCGGATAGCTTCCTGCCCGAG
CGATGGGCGGAGCCGACAAAGGCCATGAAGGATGCCTTTATGGCTTTCGGCCGTGGTCCTCGAGTCTGCATCGGC
CAGCATCTCGCTCGGATGGAGCTCCGTCTGGCTACTGCCCGCTTCTTCCTCACCTTCCCCGAGGCTCGCCCCTCG
TCACAATGGGGCATGTCCGACGACGACATGAAACCTCGTATTCATTTCTTACTGACTCCGTCCGGTGGCCGTTGT
CTCATTCAGCCTTAG
Transcript >Ophcf2|02415
ATGTCCTTCGTCTACCTCATCGCCTGCGCCTTTGCGCTCGCCATCACCCGCTCCATCATCCAGGTCCTCCGCTCA
TCCACTTCCCGCCTCCCGGGTCCGTGGTATACCAAATGGACCAGCCTCGTCCTCGACTTCCACTGGATGACGGCC
TCTCGAACGGGCTACGTTCACCGCCTACACCAGCTCTACGGCCCCATCGTCCGCCTCGCGCCCAACGAAGTAGCC
GTCTCGGACATGGAAGCCGTAAAGACCATCTACAGCACAAAGGAAACCTACCGCAAGTCCGACTTCTACCGCCGT
GTCGTCACCGTCGGCACCGAGTCGCTCTTCTCCACCGTCGACGTCGACTTTCACCGGAGGCATCGGAGGATGCTC
GCCGGTCCCATGTCCGAGTCCTCCATCAAGAACATGGCGCCTAGAGTCGAGGCTCGTGTCCAACTGGCCATCAGC
CGTATCGCAGACGAGATGAAACAGCGCGGATCGGCCGACGTCTGCAAGTGGTGGCTCTTCCTGGCGACTGATGTC
ATTGGGGAGCTCACTTTTGGCGACTCGTTCCGCATGCTGGAGCTCGGCAAGGTCAGTTTACCCATCTTTCCCGTC
GGCTCTTTGATCCAAGATGCTCACATGCACTTGTCACGACAGAAGAACGACTACGCTCGTGAGCTCGAGGACGTA
AATCGTCTAACCGCCATCCGCTCAACCTTCCCATCCATCGTCCGCTTCTGCCGCATCGTTCCCCTACCCGTCTTT
AAACGAGCGCACGAAGCCTCCATCAACCTTCGCAGTTACGCCCGCGACTCTCTCCTTCGCTACCGTCGCCTCGTC
GAAAACGACCCCAACGTCGCGCAGGAAACGCTCTTCACCAAGCTCTTTCGGGCCGAGACGGATGAGAAGCTCCCC
TTCGACGAGCTGCTTAGCGAGGCTCAGTCGTACATCGTTGCTGGCAGCGATACCACCGCCAATACACTCACCTAC
CTCACCTGGTCCATCTGTCGAAACCCCGACATCCGTTCTAAACTGGTCCAAGAGCTGCGGACCCTGCCGCCCGAC
TTTGAGGATGCTCAGCTGCACGACCTGCCCTATCTCAACAACGTCATCAATGAGTCGCTCCGCCTCTACTCGGCC
GCTCCCAACGGTCTGCCTCGTGTCGTGCCTCCGGGCGGCGCCGAGCTCGCCGGTTACCGCTTCGACGCCGATACC
GTCGTCAGCGCCCAGGCCTATAGCATGCACCGCGATCCCGTCGTCTTCCCCAACCCGGATAGCTTCCTGCCCGAG
CGATGGGCGGAGCCGACAAAGGCCATGAAGGATGCCTTTATGGCTTTCGGCCGTGGTCCTCGAGTCTGCATCGGC
CAGCATCTCGCTCGGATGGAGCTCCGTCTGGCTACTGCCCGCTTCTTCCTCACCTTCCCCGAGGCTCGCCCCTCG
TCACAATGGGGCATGTCCGACGACGACATGAAACCTCGTATTCATTTCTTACTGACTCCGTCCGGTGGCCGTTGT
CTCATTCAGCCTTAG
Gene >Ophcf2|02415
ATGTCCTTCGTCTACCTCATCGCCTGCGCCTTTGCGCTCGCCATCACCCGCGTGAGCACCGACTCACACCACAAC
CCAGACCCCTTATCCGCAAAACTAACCCACCACTCCCCAGTCCATCATCCAGGTCCTCCGCTCATCCACTTCCCG
CCTCCCGGGTCCGTGGTATACCAAATGGACCAGCCTCGTCCTCGACTTCCACTGGATGACGGCCTCTCGAACGGG
CTACGTTCACCGCCTACACCAGCTCTACGGCCCCATCGTCCGCCTCGCGCCCAACGAAGTAGCCGTCTCGGACAT
GGAAGCCGTAAAGACCATCTACAGCACAAAGGAAACCTACCGCAAGTCCGACTTCTACCGCCGTGTCGTCACCGT
CGGCACCGAGTCGCTCTTCTCCACCGTCGACGTCGACTTTCACCGGAGGCATCGGAGGATGCTCGCCGGTCCCAT
GTCCGAGTCCTCCATCAAGAACATGGCGCCTAGAGTCGAGGCTCGTGTCCAACTGGCCATCAGCCGTATCGCAGA
CGAGATGAAACAGCGCGGATCGGCCGACGTCTGCAAGTGGTGGCTCTTCCTGGCGACTGATGTCATTGGGGAGCT
CACTTTTGGCGACTCGTTCCGCATGCTGGAGCTCGGCAAGGTCAGTTTACCCATCTTTCCCGTCGGCTCTTTGAT
CCAAGATGCTCACATGCACTTGTCACGACAGAAGAACGACTACGCTCGTGAGCTCGAGGACGTAAATCGTCTAAC
CGCCATCCGCTCAACCTTCCCATCCATCGTCCGCTTCTGCCGCATCGTTCCCCTACCCGTCTTTAAACGAGCGCA
CGAAGCCTCCATCAACCTTCGCAGTTACGCCCGCGACTCTCTCCTTCGCTACCGTCGCCTCGTCGAAAACGACCC
CAACGTCGCGCAGGAAACGCTCTTCACCAAGCTCTTTCGGGCCGAGACGGATGAGAAGCTCCCCTTCGACGAGCT
GCTTAGCGAGGCTCAGTCGTACATCGTTGCTGGCAGCGATACCACCGCCAATACACTCACCTACCTCACCTGGTC
CATCTGTCGAAACCCCGACATCCGTTCTAAACTGGTCCAAGAGCTGCGGACCCTGCCGCCCGACTTTGAGGATGC
TCAGCTGCACGACCTGCCCTATCTCAACAACGTCATCAATGAGTCGCTCCGCCTCTACTCGGCCGCTCCCAACGG
TCTGCCTCGTGTCGTGCCTCCGGGCGGCGCCGAGCTCGCCGGTTACCGCTTCGACGCCGATACCGTCGTCAGCGC
CCAGGCCTATAGCATGCACCGCGATCCCGTCGTCTTCCCCAACCCGGATAGCTTCCTGCCCGAGCGATGGGCGGA
GCCGACAAAGGCCATGAAGGATGCCTTTATGGCTTTCGGCCGTGGTCCTCGAGGTTCGTCATCCTTCACCCACCA
TCGCTGATCCCTGCTGACGAGCGTCGCTCATTGCAGTCTGCATCGGCCAGCATCTCGCTCGGATGGAGCTCCGTC
TGGCTACTGCCCGCTTCTTCCTCACCTTCCCCGAGGCTCGCCCCTCGTCACAATGGGGCATGTCCGACGACGACA
TGAAACCTCGTATTCATTTCTTACTGACTCCGTCCGGTGGCCGTTGTCTCATTCAGCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail