Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02413
Gene name
Locationscaffold_02:3677933..3680282
Strand-
Gene length (bp)2349
Transcript length (bp)2241
Coding sequence length (bp)2241
Protein length (aa) 747

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.4E-21 225 458
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.0E-14 325 512
PF03552 Cellulose_synt Cellulose synthase 4.8E-10 394 536
PF00535 Glycos_transf_2 Glycosyl transferase family 2 2.7E-13 227 405
PF13506 Glyco_transf_21 Glycosyl transferase family 21 1.1E-10 320 457

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0016760 cellulose synthase (UDP-forming) activity Yes
GO:0030244 cellulose biosynthetic process Yes
GO:0035251 UDP-glucosyltransferase activity No
GO:0003824 catalytic activity No
GO:0009059 macromolecule biosynthetic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0006073 cellular glucan metabolic process No
GO:0009250 glucan biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0009987 cellular process No
GO:0000271 polysaccharide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0016759 cellulose synthase activity No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0008150 biological_process No
GO:0044249 cellular biosynthetic process No
GO:0046527 glucosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0044264 cellular polysaccharide metabolic process No
GO:0044042 glucan metabolic process No
GO:0051274 beta-glucan biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0030243 cellulose metabolic process No
GO:0003674 molecular_function No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0051273 beta-glucan metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 147 169 22
2 182 204 22
3 490 512 22
4 619 641 22
5 664 686 22
6 723 745 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02413
MADLHDLERQAMPSPLLEDRSLDLRLAAAQVAPCPPQCSDETMWSSGRKSDIQTLVHSRHESTASLGSWRTGQQT
PVSSSAKLDTLGMGGSTPMGQSSLSLSALIPKSVPQPPSKEWTEPADSIAIVGDRDDADTWRGWKRHLFRLVPLL
ILTNSLIYVLYLVYRILCIIWSQRRNNETYSAAWIFIGVEIAVAIPTLMHNSWTMLSMKKRRRPKLRLKGFEVPT
VDVFITCCGEDDDVVLDTIRAACDLDYPYDQYRVIVLDDGKSAGLEASVTRMTADCPHLYYVAREKIPGQPHHFK
AGNLNYGLDLVHRLPGGASQFMAALDADMIPEKDWLRAVLPHLLADPKMALACPPQLFYNTPLRTPLAQSLDFFV
HVIEPIKDSLGVAWCTGSGYVARREALDDIGNFPLGSLAEDVATSTHMLGKGWKTAYVHEPLQFGTVPEDYGSHL
KQRTRWAIGTVDTSFKLNFCLFGEKVRQMTIAQRFSGFLYATLSLYTIGLTISLFSIPIILLMGKRLVAYATDEQ
LRWLIRLCFAATMSNRISEYVLSVPAGYHTGQRSARYQLWMAPYIALCIVRSFMLPSWLGGTSQAFKPTGSLSSA
LNERDPLRKKNMVRRLWAILFNYMGFFHFMFVYMTLTGVALTSFRCYVTSSSVREVLMSLMTHAFWPPLTFVFIC
SSLWVPIAYAIDPPMMPDREDLLDRDVKTHVAHPTAESKKIAFGGQAAWFELELTTSTLFTALIFTLSFIF*
Coding >Ophcf2|02413
ATGGCCGACTTACATGATCTGGAACGCCAGGCGATGCCGTCGCCTCTCCTCGAGGACCGCTCGCTGGACCTGCGC
CTGGCTGCCGCCCAAGTCGCTCCCTGTCCTCCGCAGTGCTCCGACGAAACAATGTGGTCTTCAGGCCGAAAATCC
GATATACAGACGCTCGTTCATAGCCGGCATGAATCTACTGCCAGCCTTGGTTCCTGGCGGACGGGCCAGCAGACT
CCCGTCAGCTCGTCGGCAAAGCTTGACACGCTGGGCATGGGCGGATCGACTCCCATGGGCCAGAGCAGCCTCAGT
CTTTCCGCCTTGATACCCAAATCCGTTCCGCAGCCGCCCAGCAAAGAGTGGACTGAACCGGCCGACTCAATAGCC
ATCGTCGGCGACCGAGACGATGCAGACACCTGGCGCGGCTGGAAGCGTCACCTCTTCCGCCTCGTCCCGCTCCTC
ATCTTGACCAATTCCCTCATCTACGTCCTGTACCTCGTCTACCGCATACTCTGTATAATCTGGTCCCAACGTCGG
AACAACGAGACGTATTCGGCCGCCTGGATCTTCATCGGCGTCGAGATCGCCGTCGCCATCCCTACCTTGATGCAC
AACTCTTGGACCATGCTGTCGATGAAGAAGCGGAGACGGCCCAAGCTGAGGCTCAAGGGCTTCGAGGTCCCTACC
GTCGACGTCTTCATCACATGCTGCGGCGAGGATGACGACGTCGTACTCGACACGATACGCGCCGCCTGCGACCTG
GATTACCCCTACGACCAGTACAGAGTCATTGTGCTCGACGACGGAAAGTCGGCAGGTCTCGAGGCCTCGGTGACC
CGAATGACGGCCGACTGCCCTCATCTCTACTACGTGGCTCGCGAGAAGATACCCGGCCAGCCGCACCACTTCAAA
GCCGGCAATCTCAACTACGGGCTCGACCTGGTTCACCGTCTCCCTGGAGGGGCTAGCCAGTTTATGGCCGCCCTC
GACGCCGACATGATTCCCGAGAAGGACTGGCTTCGCGCCGTGCTCCCTCACCTCCTCGCCGACCCCAAGATGGCC
CTGGCCTGCCCCCCTCAGCTGTTTTACAACACGCCCCTTCGGACCCCCCTCGCTCAGAGTCTCGACTTCTTCGTC
CACGTCATCGAACCCATCAAGGATTCGCTCGGCGTCGCCTGGTGCACGGGTTCTGGTTACGTCGCCCGTCGCGAG
GCGCTCGACGACATTGGCAACTTTCCGCTCGGTTCTCTCGCCGAAGATGTGGCCACGTCGACGCACATGCTGGGC
AAGGGCTGGAAGACGGCGTACGTCCACGAGCCGCTGCAGTTTGGCACCGTCCCGGAGGACTACGGGAGCCACCTG
AAGCAGCGGACGCGATGGGCCATTGGGACCGTCGACACGTCGTTCAAGCTCAACTTTTGCCTGTTTGGCGAAAAG
GTACGGCAGATGACGATTGCCCAGCGCTTCTCGGGCTTCCTCTACGCTACGCTCAGCCTGTACACGATTGGTCTG
ACCATTTCGCTCTTCTCCATCCCCATCATCCTCTTGATGGGCAAGAGGCTGGTGGCCTACGCCACGGACGAGCAG
CTGCGATGGCTGATCCGGCTGTGCTTTGCGGCCACCATGTCGAACCGCATCTCCGAGTACGTGCTGTCGGTGCCG
GCCGGCTACCACACGGGGCAGAGGAGCGCCCGGTACCAGCTGTGGATGGCGCCCTACATCGCCCTCTGCATCGTG
CGGTCTTTCATGCTGCCCAGCTGGCTCGGCGGCACGTCGCAGGCCTTTAAGCCCACGGGGTCCCTCTCGTCGGCC
CTCAACGAGCGCGACCCGCTGCGCAAGAAGAACATGGTCCGGCGACTGTGGGCCATCCTCTTCAACTACATGGGC
TTCTTCCACTTCATGTTTGTCTACATGACGTTGACGGGCGTGGCCTTGACGTCGTTTCGCTGTTACGTGACGTCG
TCCAGCGTCCGGGAGGTGCTCATGTCGCTCATGACGCACGCCTTCTGGCCGCCTCTGACGTTTGTCTTCATCTGC
AGCTCGCTCTGGGTACCCATCGCGTACGCCATCGATCCGCCCATGATGCCCGACCGCGAAGACTTGCTGGATAGA
GACGTCAAGACGCACGTGGCTCACCCGACGGCCGAGAGCAAGAAGATCGCCTTTGGCGGGCAGGCGGCATGGTTC
GAGTTGGAGCTGACGACGTCGACGCTCTTCACTGCCCTCATATTCACTCTCTCGTTTATCTTTTAG
Transcript >Ophcf2|02413
ATGGCCGACTTACATGATCTGGAACGCCAGGCGATGCCGTCGCCTCTCCTCGAGGACCGCTCGCTGGACCTGCGC
CTGGCTGCCGCCCAAGTCGCTCCCTGTCCTCCGCAGTGCTCCGACGAAACAATGTGGTCTTCAGGCCGAAAATCC
GATATACAGACGCTCGTTCATAGCCGGCATGAATCTACTGCCAGCCTTGGTTCCTGGCGGACGGGCCAGCAGACT
CCCGTCAGCTCGTCGGCAAAGCTTGACACGCTGGGCATGGGCGGATCGACTCCCATGGGCCAGAGCAGCCTCAGT
CTTTCCGCCTTGATACCCAAATCCGTTCCGCAGCCGCCCAGCAAAGAGTGGACTGAACCGGCCGACTCAATAGCC
ATCGTCGGCGACCGAGACGATGCAGACACCTGGCGCGGCTGGAAGCGTCACCTCTTCCGCCTCGTCCCGCTCCTC
ATCTTGACCAATTCCCTCATCTACGTCCTGTACCTCGTCTACCGCATACTCTGTATAATCTGGTCCCAACGTCGG
AACAACGAGACGTATTCGGCCGCCTGGATCTTCATCGGCGTCGAGATCGCCGTCGCCATCCCTACCTTGATGCAC
AACTCTTGGACCATGCTGTCGATGAAGAAGCGGAGACGGCCCAAGCTGAGGCTCAAGGGCTTCGAGGTCCCTACC
GTCGACGTCTTCATCACATGCTGCGGCGAGGATGACGACGTCGTACTCGACACGATACGCGCCGCCTGCGACCTG
GATTACCCCTACGACCAGTACAGAGTCATTGTGCTCGACGACGGAAAGTCGGCAGGTCTCGAGGCCTCGGTGACC
CGAATGACGGCCGACTGCCCTCATCTCTACTACGTGGCTCGCGAGAAGATACCCGGCCAGCCGCACCACTTCAAA
GCCGGCAATCTCAACTACGGGCTCGACCTGGTTCACCGTCTCCCTGGAGGGGCTAGCCAGTTTATGGCCGCCCTC
GACGCCGACATGATTCCCGAGAAGGACTGGCTTCGCGCCGTGCTCCCTCACCTCCTCGCCGACCCCAAGATGGCC
CTGGCCTGCCCCCCTCAGCTGTTTTACAACACGCCCCTTCGGACCCCCCTCGCTCAGAGTCTCGACTTCTTCGTC
CACGTCATCGAACCCATCAAGGATTCGCTCGGCGTCGCCTGGTGCACGGGTTCTGGTTACGTCGCCCGTCGCGAG
GCGCTCGACGACATTGGCAACTTTCCGCTCGGTTCTCTCGCCGAAGATGTGGCCACGTCGACGCACATGCTGGGC
AAGGGCTGGAAGACGGCGTACGTCCACGAGCCGCTGCAGTTTGGCACCGTCCCGGAGGACTACGGGAGCCACCTG
AAGCAGCGGACGCGATGGGCCATTGGGACCGTCGACACGTCGTTCAAGCTCAACTTTTGCCTGTTTGGCGAAAAG
GTACGGCAGATGACGATTGCCCAGCGCTTCTCGGGCTTCCTCTACGCTACGCTCAGCCTGTACACGATTGGTCTG
ACCATTTCGCTCTTCTCCATCCCCATCATCCTCTTGATGGGCAAGAGGCTGGTGGCCTACGCCACGGACGAGCAG
CTGCGATGGCTGATCCGGCTGTGCTTTGCGGCCACCATGTCGAACCGCATCTCCGAGTACGTGCTGTCGGTGCCG
GCCGGCTACCACACGGGGCAGAGGAGCGCCCGGTACCAGCTGTGGATGGCGCCCTACATCGCCCTCTGCATCGTG
CGGTCTTTCATGCTGCCCAGCTGGCTCGGCGGCACGTCGCAGGCCTTTAAGCCCACGGGGTCCCTCTCGTCGGCC
CTCAACGAGCGCGACCCGCTGCGCAAGAAGAACATGGTCCGGCGACTGTGGGCCATCCTCTTCAACTACATGGGC
TTCTTCCACTTCATGTTTGTCTACATGACGTTGACGGGCGTGGCCTTGACGTCGTTTCGCTGTTACGTGACGTCG
TCCAGCGTCCGGGAGGTGCTCATGTCGCTCATGACGCACGCCTTCTGGCCGCCTCTGACGTTTGTCTTCATCTGC
AGCTCGCTCTGGGTACCCATCGCGTACGCCATCGATCCGCCCATGATGCCCGACCGCGAAGACTTGCTGGATAGA
GACGTCAAGACGCACGTGGCTCACCCGACGGCCGAGAGCAAGAAGATCGCCTTTGGCGGGCAGGCGGCATGGTTC
GAGTTGGAGCTGACGACGTCGACGCTCTTCACTGCCCTCATATTCACTCTCTCGTTTATCTTTTAG
Gene >Ophcf2|02413
ATGGCCGACTTACATGATCTGGAACGCCAGGCGATGCCGTCGCCTCTCCTCGAGGACCGCTCGCTGGACCTGCGC
CTGGCTGCCGCCCAAGTCGCTCCCTGTCCTCCGCAGTGCTCCGACGAAACAATGTGGTCTTCAGGCCGAAAATCC
GATATACAGACGCTCGTTCATAGCCGGCATGAATCTACTGCCAGCCTTGGTTCCTGGCGGACGGGCCAGCAGACT
CCCGTCAGCTCGTCGGCAAAGCTTGACACGCTGGGCATGGGCGGATCGACTCCCATGGTGAGTCTCGTTCCTATC
TGCGATTCGATAGCCGCAGCTGACTCGTCTTGTAGGGCCAGAGCAGCCTCAGTCTTTCCGCCTTGATACCCAAAT
CCGTTCCGCAGCCGCCCAGCAAAGAGTGGACTGAACCGGCCGACTCAATAGCCATCGTCGGCGACCGAGACGATG
CAGACACCTGGCGCGGCTGGAAGCGTCACCTCTTCCGCCTCGTCCCGCTCCTCATCTTGACCAATTCCCTCATCT
ACGTCCTGTACCTCGTCTACCGCATACTCTGTATAATCTGGTCCCAACGTCGGAACAACGAGACGTATTCGGCCG
CCTGGATCTTCATCGGCGTCGAGATCGCCGTCGCCATCCCTACCTTGATGCACAACTCTTGGACCATGCTGTCGA
TGAAGAAGCGGAGACGGCCCAAGCTGAGGCTCAAGGGCTTCGAGGTCCCTACCGTCGACGTCTTCATCACATGCT
GCGGCGAGGATGACGACGTCGTACTCGACACGATACGCGCCGCCTGCGACCTGGATTACCCCTACGACCAGTACA
GAGTCATTGTGCTCGACGACGGAAAGTCGGCAGGTCTCGAGGCCTCGGTGACCCGAATGACGGCCGACTGCCCTC
ATCTCTACTACGTGGCTCGCGAGAAGATACCCGGCCAGCCGCACCACTTCAAAGCCGGCAATCTCAACTACGGGC
TCGACCTGGTTCACCGTCTCCCTGGAGGGGCTAGCCAGTTTATGGCCGCCCTCGACGCCGACATGGTTCGTCGAT
GCCTGCCCTGGAATCCGTCCCCTTTTGCTGACGACAGTGCACCAGATTCCCGAGAAGGACTGGCTTCGCGCCGTG
CTCCCTCACCTCCTCGCCGACCCCAAGATGGCCCTGGCCTGCCCCCCTCAGCTGTTTTACAACACGCCCCTTCGG
ACCCCCCTCGCTCAGAGTCTCGACTTCTTCGTCCACGTCATCGAACCCATCAAGGATTCGCTCGGCGTCGCCTGG
TGCACGGGTTCTGGTTACGTCGCCCGTCGCGAGGCGCTCGACGACATTGGCAACTTTCCGCTCGGTTCTCTCGCC
GAAGATGTGGCCACGTCGACGCACATGCTGGGCAAGGGCTGGAAGACGGCGTACGTCCACGAGCCGCTGCAGTTT
GGCACCGTCCCGGAGGACTACGGGAGCCACCTGAAGCAGCGGACGCGATGGGCCATTGGGACCGTCGACACGTCG
TTCAAGCTCAACTTTTGCCTGTTTGGCGAAAAGGTACGGCAGATGACGATTGCCCAGCGCTTCTCGGGCTTCCTC
TACGCTACGCTCAGCCTGTACACGATTGGTCTGACCATTTCGCTCTTCTCCATCCCCATCATCCTCTTGATGGGC
AAGAGGCTGGTGGCCTACGCCACGGACGAGCAGCTGCGATGGCTGATCCGGCTGTGCTTTGCGGCCACCATGTCG
AACCGCATCTCCGAGTACGTGCTGTCGGTGCCGGCCGGCTACCACACGGGGCAGAGGAGCGCCCGGTACCAGCTG
TGGATGGCGCCCTACATCGCCCTCTGCATCGTGCGGTCTTTCATGCTGCCCAGCTGGCTCGGCGGCACGTCGCAG
GCCTTTAAGCCCACGGGGTCCCTCTCGTCGGCCCTCAACGAGCGCGACCCGCTGCGCAAGAAGAACATGGTCCGG
CGACTGTGGGCCATCCTCTTCAACTACATGGGCTTCTTCCACTTCATGTTTGTCTACATGACGTTGACGGGCGTG
GCCTTGACGTCGTTTCGCTGTTACGTGACGTCGTCCAGCGTCCGGGAGGTGCTCATGTCGCTCATGACGCACGCC
TTCTGGCCGCCTCTGACGTTTGTCTTCATCTGCAGCTCGCTCTGGGTACCCATCGCGTACGCCATCGATCCGCCC
ATGATGCCCGACCGCGAAGACTTGCTGGATAGAGACGTCAAGACGCACGTGGCTCACCCGACGGCCGAGAGCAAG
AAGATCGCCTTTGGCGGGCAGGCGGCATGGTTCGAGTTGGAGCTGACGACGTCGACGCTCTTCACTGCCCTCATA
TTCACTCTCTCGTTTATCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail