Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02411
Gene name
Locationscaffold_02:3673030..3674914
Strand-
Gene length (bp)1884
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.1E-30 104 547
PF00083 Sugar_tr Sugar (and other) transporter 4.2E-07 141 286

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 139 161 22
2 173 190 17
3 195 217 22
4 230 252 22
5 262 284 22
6 388 410 22
7 425 447 22
8 454 476 22
9 496 518 22
10 566 588 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 51.15 29.36 72.93
Alive In ants, during behavior modification 45.60 25.75 65.45
Dead In ants, recently dead 49.72 28.46 70.98

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.595110 no
Alive Dead 0.650081 no
Dead Fungus 0.906676 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02411
MARAQGGPRRPSSGPACRTLSSGSFHAGAPIPTLAGFRRASTHRYQTFPASVAPPAEAEAEAGGDDDDDDNDNDD
DDDDGAGGSSSDGSSHEHQQTPLPVRQLLLLAFLSLAEQTALNSISPYLPRMVASTPGIPPGQIGLYVGILASAF
ALAQLSTNFLWGYASDVVGRKPVLLAGTASLAGCFALFGLCRQYWHIVVVHVAMGLLNGNAACVPTVLGEVTDRS
NQSKAFTYLPVIYSIGGITGPALGGLLVGHIVPSHPYLAPNVCAAVLLAVSVAVVALWFEETLEEDDEEAGPWEP
VFLHRVSSWLRSKFRPETSNGSRSWSSRWPHAQTTDQRRPLLSPNSSLSSSSADDDHHVQDGIPSSKAAVQTKGP
AWRDLLNHTTLLLLSTYLVFQLSNISFNSLYPIFAAAPAPAGRELDPGKIGVSLSFAGLATILFQAFFYQPLKAR
TGSLGAYRLSLLGIAISMVLMPWVGYLDDEPLFGIGSGRLGLYAQLGLVLVLKNVCAVGGLSSVMLLITNSAPSH
ASLGTLNGVAQTLSALGRSFGPFVSGGLFSLSLDVRPKGEALAWSVFGGLALAGWICSLFIRGDGLESEDLDGDD
ESEDGHGRA*
Coding >Ophcf2|02411
ATGGCCCGCGCCCAGGGCGGCCCGCGTCGGCCCAGCTCCGGCCCCGCCTGCCGGACGCTGTCCTCCGGCTCGTTC
CACGCCGGGGCGCCCATTCCGACGCTGGCGGGCTTCCGGCGGGCCTCGACGCATCGTTATCAGACTTTTCCCGCG
AGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGAGGCTGGTGGTGATGACGATGATGACGACAACGACAACGACGAT
GATGACGACGATGGGGCTGGGGGTAGCTCCAGCGACGGTTCCTCGCACGAGCACCAGCAGACTCCTCTCCCCGTC
CGCCAGCTCCTCCTACTAGCCTTTCTCTCTCTCGCCGAGCAGACGGCCCTCAATTCCATCTCGCCTTACCTCCCG
CGCATGGTAGCCTCGACGCCCGGTATCCCTCCGGGCCAGATCGGGCTGTACGTCGGTATCCTGGCCAGTGCCTTT
GCCCTGGCTCAGCTCTCGACCAACTTTCTCTGGGGCTACGCCTCTGATGTCGTCGGTCGTAAGCCCGTGCTTCTG
GCTGGCACTGCGTCATTGGCTGGCTGTTTTGCCCTCTTTGGACTGTGTCGGCAATACTGGCATATTGTTGTCGTT
CACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCCTGCGTGCCTACTGTTCTCGGCGAAGTGACTGACCGGTCG
AATCAGAGCAAGGCTTTTACCTACCTGCCCGTCATCTACTCCATAGGCGGCATCACTGGTCCGGCCCTCGGCGGC
TTGTTGGTCGGCCACATAGTGCCGAGTCACCCGTACCTTGCGCCCAACGTCTGCGCTGCCGTCCTACTCGCCGTC
AGTGTCGCCGTCGTCGCCCTCTGGTTTGAGGAGACGCTTGAAGAGGATGACGAGGAGGCGGGACCGTGGGAACCC
GTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCCAAGTTTCGTCCCGAGACGAGCAACGGTTCTCGTTCCTGG
AGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAGCGCAGGCCCTTGCTATCGCCGAATTCGTCTCTCTCGTCT
TCTTCCGCCGACGATGACCACCATGTCCAAGACGGCATACCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGTCCC
GCCTGGCGGGATCTCCTGAACCACACGACGCTCCTCCTTCTCTCCACCTACCTCGTCTTTCAGCTGTCCAACATC
AGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCACCTGCACCGGCGGGCCGCGAGTTGGACCCCGGCAAGATC
GGAGTCAGCCTTAGCTTCGCCGGTCTGGCCACCATTCTATTCCAGGCCTTCTTCTACCAGCCGCTCAAGGCCAGG
ACCGGGAGCCTCGGCGCGTACCGCCTGTCGCTGCTGGGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTGGGC
TATCTCGACGATGAGCCGCTGTTTGGCATTGGCAGCGGCCGTCTTGGGCTCTATGCACAGCTCGGCCTTGTTTTG
GTTTTGAAGAATGTTTGCGCTGTTGGCGGCCTTTCGAGCGTCATGCTTCTGATCACCAACTCAGCCCCGTCGCAC
GCCAGCCTCGGCACACTCAACGGCGTGGCCCAAACGCTGTCGGCGCTGGGTCGCAGCTTTGGGCCCTTTGTCTCT
GGCGGCCTCTTTTCCCTGTCCCTCGATGTGCGGCCCAAGGGCGAGGCTCTCGCGTGGAGTGTCTTTGGAGGGCTT
GCACTAGCCGGCTGGATCTGTTCGCTCTTCATCCGCGGCGACGGTCTGGAGAGCGAGGATCTGGACGGCGACGAC
GAGTCGGAAGATGGCCATGGCCGCGCCTGA
Transcript >Ophcf2|02411
ATGGCCCGCGCCCAGGGCGGCCCGCGTCGGCCCAGCTCCGGCCCCGCCTGCCGGACGCTGTCCTCCGGCTCGTTC
CACGCCGGGGCGCCCATTCCGACGCTGGCGGGCTTCCGGCGGGCCTCGACGCATCGTTATCAGACTTTTCCCGCG
AGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGAGGCTGGTGGTGATGACGATGATGACGACAACGACAACGACGAT
GATGACGACGATGGGGCTGGGGGTAGCTCCAGCGACGGTTCCTCGCACGAGCACCAGCAGACTCCTCTCCCCGTC
CGCCAGCTCCTCCTACTAGCCTTTCTCTCTCTCGCCGAGCAGACGGCCCTCAATTCCATCTCGCCTTACCTCCCG
CGCATGGTAGCCTCGACGCCCGGTATCCCTCCGGGCCAGATCGGGCTGTACGTCGGTATCCTGGCCAGTGCCTTT
GCCCTGGCTCAGCTCTCGACCAACTTTCTCTGGGGCTACGCCTCTGATGTCGTCGGTCGTAAGCCCGTGCTTCTG
GCTGGCACTGCGTCATTGGCTGGCTGTTTTGCCCTCTTTGGACTGTGTCGGCAATACTGGCATATTGTTGTCGTT
CACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCCTGCGTGCCTACTGTTCTCGGCGAAGTGACTGACCGGTCG
AATCAGAGCAAGGCTTTTACCTACCTGCCCGTCATCTACTCCATAGGCGGCATCACTGGTCCGGCCCTCGGCGGC
TTGTTGGTCGGCCACATAGTGCCGAGTCACCCGTACCTTGCGCCCAACGTCTGCGCTGCCGTCCTACTCGCCGTC
AGTGTCGCCGTCGTCGCCCTCTGGTTTGAGGAGACGCTTGAAGAGGATGACGAGGAGGCGGGACCGTGGGAACCC
GTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCCAAGTTTCGTCCCGAGACGAGCAACGGTTCTCGTTCCTGG
AGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAGCGCAGGCCCTTGCTATCGCCGAATTCGTCTCTCTCGTCT
TCTTCCGCCGACGATGACCACCATGTCCAAGACGGCATACCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGTCCC
GCCTGGCGGGATCTCCTGAACCACACGACGCTCCTCCTTCTCTCCACCTACCTCGTCTTTCAGCTGTCCAACATC
AGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCACCTGCACCGGCGGGCCGCGAGTTGGACCCCGGCAAGATC
GGAGTCAGCCTTAGCTTCGCCGGTCTGGCCACCATTCTATTCCAGGCCTTCTTCTACCAGCCGCTCAAGGCCAGG
ACCGGGAGCCTCGGCGCGTACCGCCTGTCGCTGCTGGGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTGGGC
TATCTCGACGATGAGCCGCTGTTTGGCATTGGCAGCGGCCGTCTTGGGCTCTATGCACAGCTCGGCCTTGTTTTG
GTTTTGAAGAATGTTTGCGCTGTTGGCGGCCTTTCGAGCGTCATGCTTCTGATCACCAACTCAGCCCCGTCGCAC
GCCAGCCTCGGCACACTCAACGGCGTGGCCCAAACGCTGTCGGCGCTGGGTCGCAGCTTTGGGCCCTTTGTCTCT
GGCGGCCTCTTTTCCCTGTCCCTCGATGTGCGGCCCAAGGGCGAGGCTCTCGCGTGGAGTGTCTTTGGAGGGCTT
GCACTAGCCGGCTGGATCTGTTCGCTCTTCATCCGCGGCGACGGTCTGGAGAGCGAGGATCTGGACGGCGACGAC
GAGTCGGAAGATGGCCATGGCCGCGCCTGA
Gene >Ophcf2|02411
ATGGCCCGCGCCCAGGGCGGCCCGCGTCGGCCCAGCTCCGGCCCCGCCTGCCGGACGCTGTCCTCCGGCTCGTTC
CACGCCGGGGCGCCCATTCCGACGCTGGCGGGCTTCCGGCGGGCCTCGACGCATCGTTATCAGACTTTTCCCGCG
AGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGAGGCTGGTGGTGATGACGATGATGACGACAACGACAACGACGAT
GATGACGACGATGGGGCTGGGGGTAGCTCCAGCGACGGTTCCTCGCACGAGCACCAGCAGACTCCTCTCCCCGTC
CGCCAGCTCCTCCTACTAGCCTTTCTCTCTCTCGCCGAGCAGACGGCCCTCAATTCCATCTCGCCTTACCTCCCG
CGCATGGTAGCCTCGACGCCCGGTATCCCTCCGGGCCAGATCGGGCTGTACGTCGGTATCCTGGCCAGTGCCTTT
GCCCTGGCTCAGCTCTCGACCAACTTTCTCTGGGGCTACGCCTCTGATGTCGTCGGTCGTAAGCCCGTGCTTCTG
GCTGGCACTGCGTCATTGGCTGGCTGTTTTGCCCTCTTTGGACTGTGTCGGCAATACTGGCATATTGTTGTCGTT
CACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCCTGCGTGCCTACTGTTCTCGGCGAAGTGACTGACCGGTCG
AATCAGAGCAAGGCTTTTACCTACCTGCCCGTCATCTACTCCATAGGCGGCATCACTGGTCCGGCCCTCGGCGGC
TTGTTGGTCGGCCACATAGTGCCGAGTCACCCGTACCTTGCGCCCAACGTCTGCGCTGCCGTCCTACTCGCCGTC
AGTGTCGCCGTCGTCGCCCTCTGGTTTGAGGAGACGCTTGAAGAGGATGACGAGGAGGCGGGACCGTGGGAACCC
GTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCCAAGTTTCGTCCCGAGACGAGCAACGGTTCTCGTTCCTGG
AGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAGCGCAGGCCCTTGCTATCGCCGAATTCGTCTCTCTCGTCT
TCTTCCGCCGACGATGACCACCATGTCCAAGACGGCATACCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGTCCC
GCCTGGCGGGATCTCCTGAACCACACGACGCTCCTCCTTCTCTCCACCTACCTCGTCTTTCAGCTGTCCAACATC
AGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCACCTGCACCGGCGGGCCGCGAGTTGGACCCCGGCAAGATC
GGAGTCAGCCTTAGCTTCGCCGGTCTGGCCACCATTCTATTCCAGGCCTTCTTCTACCAGCCGCTCAAGGCCAGG
ACCGGGAGCCTCGGCGCGTACCGCCTGTCGCTGCTGGGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTGGGC
TATCTCGACGATGAGCCGCTGTTTGGCATTGGCAGCGGCCGTCTTGGGCTCTATGCACAGCTCGGCCTTGTTTTG
GTTTTGAAGAATGTTTGCGCTGTTGGCGGCCTTTCGAGCGTCATGCTTCTGGTACGGCGTGCCATCTTTCCCGAT
CTCCTCTTTACCTGGCTGACACGTTTCCAGATCACCAACTCAGCCCCGTCGCACGCCAGCCTCGGCACACTCAAC
GGCGTGGCCCAAACGCTGTCGGCGCTGGGTCGCAGCTTTGGGCCCTTTGTCTCTGGCGGCCTCTTTTCCCTGTCC
CTCGATGTGCGGCCCAAGGGCGAGGCTCTCGCGTGGAGTGTCTTTGGAGGGCTTGCACTAGCCGGCTGGATCTGT
TCGCTCTTCATCCGCGGCGACGGTCTGGAGAGCGAGGATCTGGACGGCGACGACGAGTCGGAAGATGGCCATGGC
CGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail