Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02409
Gene name
Locationscaffold_02:3669086..3670410
Strand+
Gene length (bp)1324
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 1.9E-51 1 189
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 1.4E-18 267 389

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.4889 0.3634 0.6552 0.0438 0.3288 0.0175 0.1132 0.0436 0.0088 0.582

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3230
Ophiocordyceps australis 1348a (Ghana) OphauG2|6609
Ophiocordyceps australis map64 (Brazil) OphauB2|1642
Ophiocordyceps australis map64 (Brazil) OphauB2|3863
Ophiocordyceps camponoti-floridani Ophcf2|02409 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06740
Ophiocordyceps camponoti-rufipedis Ophun1|2588
Ophiocordyceps camponoti-rufipedis Ophun1|858
Ophiocordyceps kimflemingae Ophio5|6050
Ophiocordyceps kimflemingae Ophio5|914
Ophiocordyceps subramaniannii Hirsu2|7282
Ophiocordyceps subramaniannii Hirsu2|9336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02409
MYHSGIGGGGFMTIRAPDGRFETVDFREVAPVAAFEDILLTMMVMMAVYSGVPGEPRGLEYLHSKYGKLEWFQVV
EPVVHLARFGFVVTGDLASRIASVEDASFLTQDASWALDFAPRGRLLQQGEVMTRKRYADTLEAIALRGVDAFYS
GAIAQATIAGLRARNGTMTMEDLANYTVVHREPIPSQLSRLQADQLQRPFRWHRSSKRAQHSQQLRHARRPITIQ
PVNPPSRRGHQIRLRSTYETRRSVICRRDHPDGLDGLSRALSIPGVSNGFGYIPSPSNYIRPGKRPLSSISPIIA
ETIDGKLLFSLGAAGGSRITTATIQNTMHLLDRHLVPTTVTFEYAFDNSTVAYMKSLHHNASWVPPGQSLAQGVR
LLSNGTFEAAGEPRLVASGGFAV*
Coding >Ophcf2|02409
ATGTATCACAGCGGCATTGGCGGCGGCGGCTTCATGACGATTCGAGCCCCTGACGGTCGGTTCGAGACGGTTGAC
TTCCGTGAAGTTGCTCCGGTTGCTGCTTTCGAGGACATATTGCTGACGATGATGGTGATGATGGCCGTCTACAGT
GGTGTTCCGGGAGAGCCGAGGGGGCTCGAATACCTCCACTCGAAATACGGCAAGTTAGAATGGTTCCAAGTCGTC
GAGCCAGTCGTCCATCTCGCCCGCTTTGGCTTCGTCGTAACCGGAGACCTAGCCAGCAGAATAGCCAGCGTCGAA
GACGCCTCCTTCTTAACTCAAGATGCATCCTGGGCCCTCGACTTCGCACCCCGAGGCCGTCTCCTCCAGCAAGGA
GAAGTCATGACGCGGAAACGCTACGCTGATACCCTCGAGGCCATTGCTCTCCGAGGCGTAGATGCCTTCTACTCA
GGTGCCATCGCCCAGGCCACCATCGCCGGCCTCCGAGCCCGCAACGGGACCATGACGATGGAAGACCTGGCAAAC
TACACCGTCGTCCACCGCGAGCCCATCCCATCTCAACTATCGCGGCTTCAAGCTGACCAGTTGCAACGCCCCTTC
AGGTGGCATCGTAGCTCTAAGCGCGCTCAACATTCTCAGCAACTACGACACGCTCGGCGGCCCATCACAATTCAA
CCTGTCAACCCACCGTCTCGACGAGGCCATCAGATTCGCCTACGGTCAACGTACGAAACTCGGCGATCCGTCATT
TGTCGACGTGACCACCCTGACGGCCTCGATGGTCTCTCCCGAGCACTTAGCATCCCCGGCGTCAGCAACGGCTTC
GGCTACATCCCCAGTCCATCCAACTACATCCGTCCAGGCAAACGTCCCCTATCCTCCATCTCGCCCATCATCGCC
GAGACAATCGACGGCAAGCTGCTCTTCAGCCTGGGCGCCGCGGGAGGAAGCCGTATCACGACAGCCACGATCCAA
AACACCATGCACCTGCTGGACCGACACCTGGTTCCGACCACGGTGACGTTTGAGTACGCCTTTGACAACAGCACC
GTGGCTTACATGAAATCGCTGCATCACAACGCGAGCTGGGTGCCGCCAGGGCAGAGCTTGGCCCAGGGCGTCCGG
CTACTGTCCAACGGCACGTTTGAGGCTGCCGGTGAGCCGAGGCTGGTAGCTTCTGGGGGGTTTGCGGTCTGA
Transcript >Ophcf2|02409
ATGTATCACAGCGGCATTGGCGGCGGCGGCTTCATGACGATTCGAGCCCCTGACGGTCGGTTCGAGACGGTTGAC
TTCCGTGAAGTTGCTCCGGTTGCTGCTTTCGAGGACATATTGCTGACGATGATGGTGATGATGGCCGTCTACAGT
GGTGTTCCGGGAGAGCCGAGGGGGCTCGAATACCTCCACTCGAAATACGGCAAGTTAGAATGGTTCCAAGTCGTC
GAGCCAGTCGTCCATCTCGCCCGCTTTGGCTTCGTCGTAACCGGAGACCTAGCCAGCAGAATAGCCAGCGTCGAA
GACGCCTCCTTCTTAACTCAAGATGCATCCTGGGCCCTCGACTTCGCACCCCGAGGCCGTCTCCTCCAGCAAGGA
GAAGTCATGACGCGGAAACGCTACGCTGATACCCTCGAGGCCATTGCTCTCCGAGGCGTAGATGCCTTCTACTCA
GGTGCCATCGCCCAGGCCACCATCGCCGGCCTCCGAGCCCGCAACGGGACCATGACGATGGAAGACCTGGCAAAC
TACACCGTCGTCCACCGCGAGCCCATCCCATCTCAACTATCGCGGCTTCAAGCTGACCAGTTGCAACGCCCCTTC
AGGTGGCATCGTAGCTCTAAGCGCGCTCAACATTCTCAGCAACTACGACACGCTCGGCGGCCCATCACAATTCAA
CCTGTCAACCCACCGTCTCGACGAGGCCATCAGATTCGCCTACGGTCAACGTACGAAACTCGGCGATCCGTCATT
TGTCGACGTGACCACCCTGACGGCCTCGATGGTCTCTCCCGAGCACTTAGCATCCCCGGCGTCAGCAACGGCTTC
GGCTACATCCCCAGTCCATCCAACTACATCCGTCCAGGCAAACGTCCCCTATCCTCCATCTCGCCCATCATCGCC
GAGACAATCGACGGCAAGCTGCTCTTCAGCCTGGGCGCCGCGGGAGGAAGCCGTATCACGACAGCCACGATCCAA
AACACCATGCACCTGCTGGACCGACACCTGGTTCCGACCACGGTGACGTTTGAGTACGCCTTTGACAACAGCACC
GTGGCTTACATGAAATCGCTGCATCACAACGCGAGCTGGGTGCCGCCAGGGCAGAGCTTGGCCCAGGGCGTCCGG
CTACTGTCCAACGGCACGTTTGAGGCTGCCGGTGAGCCGAGGCTGGTAGCTTCTGGGGGGTTTGCGGTCTGA
Gene >Ophcf2|02409
ATGTATCACAGCGGCATTGGCGGCGGCGGCTTCATGACGATTCGAGCCCCTGACGGTCGGTTCGAGACGGTTGAC
TTCCGTGAAGTTGCTCCGGTTGCTGCTTTCGAGGACATGTTTGCCACAGGCTAGCATGGTTGGGGGGGGGGGACT
GGCGAGGTATATCACGGCCTTTTGTTCTTGACGTCAGGCGTAGATTGCTGACGATGATGGTGATGATGGCCGTCT
ACAGTGGTGTTCCGGGAGAGCCGAGGGGGCTCGAATACCTCCACTCGAAATACGGCAAGTTAGAATGGTTCCAAG
TCGTCGAGCCAGTCGTCCATCTCGCCCGCTTTGGCTTCGTCGTAACCGGAGACCTAGCCAGCAGAATAGCCAGCG
TCGAAGACGCCTCCTTCTTAACTCAAGATGCATCCTGGGCCCTCGACTTCGCACCCCGAGGCCGTCTCCTCCAGC
AAGGAGAAGTCATGACGCGGAAACGCTACGCTGATACCCTCGAGGCCATTGCTCTCCGAGGCGTAGATGCCTTCT
ACTCAGGTGCCATCGCCCAGGCCACCATCGCCGGCCTCCGAGCCCGCAACGGGACCATGACGATGGAAGACCTGG
CAAACTACACCGTCGTCCACCGCGAGCCCATCCCATCTCAACTATCGCGGCTTCAAGCTGACCAGTTGCAACGCC
CCTTCAGGTGGCATCGTAGCTCTAAGCGCGCTCAACATTCTCAGCAACTACGACACGCTCGGCGGCCCATCACAA
TTCAACCTGTCAACCCACCGTCTCGACGAGGCCATCAGATTCGCCTACGGTCAACGTACGAAACTCGGCGATCCG
TCATTTGTCGACGTGACCACCCTGACGGCCTCGATGGTCTCTCCCGAGCACTTAGCATCCCCGGCGTCAGCAACG
GCTTCGGCTACATCCCCAGTCCATCCAACTACATCCGTCCAGGCAAACGTCCCCTATCCTCCATCTCGCCCATCA
TCGCCGAGACAATCGACGGCAAGCTGCTCTTCAGCCTGGGCGCCGCGGGAGGAAGCCGTATCACGACAGCCACGA
TCCAAAACACCATGCACCTGCTGGACCGACACGTGAACATGGCCGTGGCACTACGTCAGCCGCGTCTGCACACGA
CCAGCTGGTTCCGACCACGGTGACGTTTGAGTACGCCTTTGACAACAGCACCGTGGCTTACATGAAATCGCTGCA
TCACAACGCGAGCTGGGTGCCGCCAGGGCAGAGCTTGGCCCAGGGCGTCCGGCTACTGTCCAACGGCACGTTTGA
GGCTGCCGGTGAGCCGAGGCTGGTAGCTTCTGGGGGGTTTGCGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail