Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02407
Gene name
Locationscaffold_02:3621427..3622319
Strand-
Gene length (bp)892
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12542 CWC25 Pre-mRNA splicing factor 2.3E-26 66 157
PF10197 Cir_N N-terminal domain of CBF1 interacting co-repressor CIR 2.4E-12 11 47

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.409 0.698 0.0331 0.0403 0.0461 0.0029 0.1373 0.0759 0.1865 0.0109

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4976
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7739
Ophiocordyceps australis map64 (Brazil) OphauB2|2798
Ophiocordyceps camponoti-floridani Ophcf2|02407 (this protein)
Ophiocordyceps kimflemingae Ophio5|4405
Ophiocordyceps subramaniannii Hirsu2|2129

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02407
MGGGDLNLKKSFHPTLQRNQRAVYEEEQKALAERKRTQQRINEIKEERAKEDLQRQLEAAGGKKRADRVDWMYQG
PTDGQAGATEEMEAYLLGKRRIDNIIKGTEHKKLEKSAGQDSFMALQNANSARDTAAKIRDDPLLAIKRQEQAAY
DAMLNDPIKRRQLLSSMGIDDEKKMMRGGIGDEGAGKMKGGVTGDGAERTRNDITDDEAERMRNVITDDEAQRTR
DGIMSHGAKMIKDGHVAAETTSKGIAAAIDRDRVVHGVQTMGDKARSRDGC*
Coding >Ophcf2|02407
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTACGAA
GAGGAGCAGAAGGCTCTCGCAGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAAGAGCGCGCAAAG
GAGGACCTCCAGCGGCAACTCGAGGCTGCGGGAGGTAAAAAGAGAGCGGATCGTGTCGACTGGATGTATCAGGGC
CCGACAGATGGCCAGGCCGGGGCGACAGAGGAGATGGAGGCCTACCTGCTGGGCAAGCGGAGGATAGATAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAC
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAT
GACGCCATGTTGAACGACCCGATTAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGACGAGAAGAAGATG
ATGAGGGGCGGCATCGGAGACGAAGGAGCAGGGAAGATGAAGGGCGGCGTCACCGGCGACGGAGCAGAGAGGACG
AGGAACGACATCACCGACGACGAAGCAGAGAGAATGAGGAACGTCATCACCGACGACGAAGCACAGAGGACGAGA
GACGGCATCATGAGCCACGGAGCCAAGATGATCAAGGATGGACACGTCGCAGCAGAGACGACGAGCAAGGGCATC
GCCGCCGCTATCGATCGCGATCGCGTAGTCCACGGCGTTCAAACGATGGGAGATAAAGCGAGAAGCAGAGATGGA
TGCTGA
Transcript >Ophcf2|02407
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTACGAA
GAGGAGCAGAAGGCTCTCGCAGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAAGAGCGCGCAAAG
GAGGACCTCCAGCGGCAACTCGAGGCTGCGGGAGGTAAAAAGAGAGCGGATCGTGTCGACTGGATGTATCAGGGC
CCGACAGATGGCCAGGCCGGGGCGACAGAGGAGATGGAGGCCTACCTGCTGGGCAAGCGGAGGATAGATAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAC
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAT
GACGCCATGTTGAACGACCCGATTAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGACGAGAAGAAGATG
ATGAGGGGCGGCATCGGAGACGAAGGAGCAGGGAAGATGAAGGGCGGCGTCACCGGCGACGGAGCAGAGAGGACG
AGGAACGACATCACCGACGACGAAGCAGAGAGAATGAGGAACGTCATCACCGACGACGAAGCACAGAGGACGAGA
GACGGCATCATGAGCCACGGAGCCAAGATGATCAAGGATGGACACGTCGCAGCAGAGACGACGAGCAAGGGCATC
GCCGCCGCTATCGATCGCGATCGCGTAGTCCACGGCGTTCAAACGATGGGAGATAAAGCGAGAAGCAGAGATGGA
TGCTGA
Gene >Ophcf2|02407
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTACGAA
GAGGAGCAGAAGGCTCTCGCAGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAAGAGCGCGCAAAG
GAGGACCTCCAGCGGCAACTCGAGGCTGCGGGAGGTAAAAAGAGAGCGGATCGTGTCGACTGGATGTATCAGGGC
CCGACAGATGGCCAGGCCGGGGCGACAGAGGAGATGGAGGCCTACCTGCTGGGCAAGCGGAGGATAGATAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAC
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAT
GACGCCATGTTGAACGACCCGATTAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGACGAGAAGAGTCGG
AGACGATCAGAGACGGAAAGCAGACATGGGCGCAGGCATCATAGACGACGGAGCAGAGATGATGAGGGGCGGCAT
CGGAGACGAAGGAGCAGGGAAGATGAAGGGCGGCGTCACCGGCGACGGAGCAGAGAGGACGAGGAACGACATCAC
CGACGACGAAGCAGAGAGAATGAGGAACGTCATCACCGACGACGAAGCACAGAGGACGAGAGACGGCATCATGAG
CCACGGAGCCAAGATGATCAAGGATGGACACGTCGCAGCAGAGACGACGAGCAAGGGCATCGCCGCCGCTATCGA
TCGCGATCGCGTAGTCCACGGCGTTCAAACGATGGGAGATAAAGCGAGAAGCAGAGATGGATGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail