Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02406
Gene name
Locationscaffold_02:3619705..3620554
Strand-
Gene length (bp)849
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 5.7E-53 15 190
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 9.2E-21 15 128
PF00025 Arf ADP-ribosylation factor family 1.7E-07 13 138

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole 0.3607 0.1971 0.0224 0.6442 0.2286 0.1288 0.306 0.6597 0.6522 0.0813

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7738
Ophiocordyceps australis map64 (Brazil) OphauB2|2797
Ophiocordyceps camponoti-floridani Ophcf2|02406 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|855
Ophiocordyceps kimflemingae Ophio5|4406
Ophiocordyceps subramaniannii Hirsu2|2130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02406
MPLVLCGGSKTVQRKLVLLGDGACGKTSLLNVFTRGYFPTVYEPTVFENYVHDIFVDSVHIELSLWDTAGQEEFD
RLRSLSYDDTDLIMLCYSVDSKDSLENVESKWVGEIADNCPGVKLVLVALKCDLREQSEDEDAPVPDDRREKGPL
INYDQGLEVARRIGASRYLECSAMKNRGVNEAFTEAARVALSVNKERKEKKCIVM*
Coding >Ophcf2|02406
ATGCCCCTTGTTCTCTGCGGCGGATCCAAGACGGTCCAGCGCAAGCTGGTTCTGCTGGGAGACGGTGCCTGTGGC
AAGACTTCACTGCTCAACGTCTTTACCAGAGGTTACTTCCCAACCGTCTACGAACCGACCGTCTTCGAAAACTAC
GTGCACGACATCTTCGTTGACAGCGTCCACATCGAGCTATCGCTATGGGACACGGCCGGCCAGGAGGAGTTTGAC
CGGCTGCGGTCGCTGTCGTACGATGACACGGACCTCATCATGCTGTGCTACTCGGTCGACAGCAAGGACTCGCTC
GAAAACGTCGAATCCAAGTGGGTGGGCGAGATAGCCGATAACTGTCCCGGCGTCAAGCTGGTGCTCGTCGCGCTC
AAGTGCGATCTGCGCGAGCAGAGCGAAGACGAAGACGCGCCCGTGCCAGACGACCGTCGCGAAAAGGGCCCGCTC
ATCAACTACGATCAAGGTCTAGAGGTGGCCCGTCGGATAGGCGCCTCTCGCTACCTCGAGTGCTCCGCCATGAAG
AACCGGGGCGTCAACGAGGCCTTTACCGAGGCTGCCCGCGTCGCCCTCAGCGTCAACAAGGAGCGCAAAGAGAAG
AAGTGCATCGTCATGTGA
Transcript >Ophcf2|02406
ATGCCCCTTGTTCTCTGCGGCGGATCCAAGACGGTCCAGCGCAAGCTGGTTCTGCTGGGAGACGGTGCCTGTGGC
AAGACTTCACTGCTCAACGTCTTTACCAGAGGTTACTTCCCAACCGTCTACGAACCGACCGTCTTCGAAAACTAC
GTGCACGACATCTTCGTTGACAGCGTCCACATCGAGCTATCGCTATGGGACACGGCCGGCCAGGAGGAGTTTGAC
CGGCTGCGGTCGCTGTCGTACGATGACACGGACCTCATCATGCTGTGCTACTCGGTCGACAGCAAGGACTCGCTC
GAAAACGTCGAATCCAAGTGGGTGGGCGAGATAGCCGATAACTGTCCCGGCGTCAAGCTGGTGCTCGTCGCGCTC
AAGTGCGATCTGCGCGAGCAGAGCGAAGACGAAGACGCGCCCGTGCCAGACGACCGTCGCGAAAAGGGCCCGCTC
ATCAACTACGATCAAGGTCTAGAGGTGGCCCGTCGGATAGGCGCCTCTCGCTACCTCGAGTGCTCCGCCATGAAG
AACCGGGGCGTCAACGAGGCCTTTACCGAGGCTGCCCGCGTCGCCCTCAGCGTCAACAAGGAGCGCAAAGAGAAG
AAGTGCATCGTCATGTGA
Gene >Ophcf2|02406
ATGCCCCTTGTTCTCTGCGGCGGATCCAAGACGGTCCAGCGCAAGCTGGTTCTGCTGTACGTGGCCAAAAGCTAT
GCACGCTCACGGTGGCGAGATGCTGACATGCAATCTGCAGGGGAGACGGTGCCTGTGGCAAGACTTCACTGCTCA
ACGTCTTTACCAGAGGGTACGCTGTCTCCGTCGACGGGATATCGGCTGCCATTTCTCACCTCGATGCTCAGTTAC
TTCCCAACCGTCTACGAACCGACCGTCTTCGAAAACTACGTGCACGGTACGAGGGCAACCAGCGGCGGATGCCTG
CCCCCTGGAGACGCGACGCTAACGAGACAACGGCGGTAGACATCTTCGTTGACAGCGTCCACATCGAGCTATCGC
TATGGGACACGGCCGGCCAGGAGGAGTTTGACCGGCTGCGGTCGCTGTCGTACGGTACGTGGAGCGTCCAAGCAA
GGCGAGACTCGGCTAACGCGTTCGACAGATGACACGGACCTCATCATGCTGTGCTACTCGGTCGACAGCAAGGAC
TCGCTCGAAAACGTCGAATCCAAGTGGGTGGGCGAGATAGCCGATAACTGTCCCGGCGTCAAGCTGGTGCTCGTC
GCGCTCAAGTGCGATCTGCGCGAGCAGAGCGAAGACGAAGACGCGCCCGTGCCAGACGACCGTCGCGAAAAGGGC
CCGCTCATCAACTACGATCAAGGTCTAGAGGTGGCCCGTCGGATAGGCGCCTCTCGCTACCTCGAGTGCTCCGCC
ATGAAGAACCGGGGCGTCAACGAGGCCTTTACCGAGGCTGCCCGCGTCGCCCTCAGCGTCAACAAGGAGCGCAAA
GAGAAGAAGTGCATCGTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail