Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02403
Gene name
Locationscaffold_02:3609144..3611170
Strand+
Gene length (bp)2026
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-32 136 532
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.8E-13 202 547

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 162 181 19
3 216 238 22
4 250 272 22
5 282 304 22
6 317 339 22
7 354 373 19
8 390 412 22
9 427 449 22
10 456 474 18
11 484 506 22
12 515 537 22
13 588 610 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02403
MPRPVRQPPREGESTSRPISGILSPWRFSTIGSDELSVFSPLEETHITALDFVFPSRRVSWRQSAASNAELVTRF
PARAPTVAKIRQSTSSLTESPVDASGTDAHSISSWNLHHGEDPTAEPEPEPEYPTGFTLWIMIAALISSIFLIAL
DMANEFHGLQDVAWYSAIFFMTAGGFQSTWGKTYKSFPLKVGVLTAISIFEAGNLICGVAPSSSVFIVGRAIAGV
GAAGVGSGSYTLVAFIAEPEKRAAYTGLLGAIFGIGSVLGPLLGGVFSSRSTWRWCFYINLPIGVLPVITLVFFF
RPPATAKPQEAPLREKLLGMDPLGTCLLMGVIITYLMAVHYGGQISPWSSPPVVGLLVGSFVLALAFALCEYWQG
DRAIVIPRLLSQRRIGLSAVFTILQSGAFFSMIYYLPLYFQAIRGSDAVVSGVQNLPFILAAMLGALGAGVFISS
TGMSTLVMVAGTALGTLGCGLCYMFDVNTSSGTWIGFQIIAGVSLGAALQIPVIVGQVSVQPRDLSSATSMMLCF
QTLGGAIWTSAAQSAFVNRMMATLPELAPGIDPMKVVATGAGQLRGVFAAGELDGVLAAYLEGIRTAFILSCAIA
GGACILGVFLPWKRLDVVAVRENSGGG*
Coding >Ophcf2|02403
ATGCCTAGACCTGTCCGGCAACCTCCCCGGGAAGGGGAGTCGACGTCACGGCCCATCAGCGGCATCTTGTCGCCA
TGGCGCTTCTCGACCATCGGCTCCGATGAGCTCTCCGTCTTCAGCCCGCTCGAGGAGACGCACATCACGGCCCTC
GACTTCGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGCTGCCAGTAATGCAGAGCTCGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGCTCGTTGACTGAGTCGCCTGTCGATGCGTCG
GGTACGGACGCGCATTCCATAAGCTCCTGGAATCTCCATCACGGCGAGGATCCCACCGCGGAGCCGGAGCCGGAG
CCCGAGTACCCTACCGGATTCACTCTATGGATCATGATAGCAGCCCTCATCTCTAGCATCTTTCTCATCGCTCTA
GACATGGCAAACGAGTTCCACGGCCTTCAAGACGTAGCCTGGTACAGCGCCATCTTCTTCATGACCGCCGGCGGC
TTCCAATCAACTTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAAGTCGGCGTCCTGACGGCCATTTCCATCTTC
GAAGCGGGAAACCTCATCTGCGGAGTGGCGCCCAGCTCCTCCGTCTTCATCGTCGGCCGTGCCATCGCAGGCGTC
GGAGCAGCGGGCGTCGGATCCGGCTCGTACACCCTCGTTGCCTTCATCGCCGAGCCTGAGAAGAGAGCGGCTTAT
ACCGGTCTTCTCGGGGCCATCTTCGGCATCGGGAGTGTGCTGGGTCCGCTTCTGGGCGGTGTGTTCTCCAGTAGG
AGCACGTGGAGATGGTGCTTTTACATCAACCTCCCGATAGGCGTGCTCCCCGTCATCACCCTGGTGTTCTTCTTC
CGCCCTCCCGCGACGGCAAAGCCTCAAGAAGCGCCCCTGAGAGAGAAGCTATTAGGGATGGATCCGCTCGGCACA
TGTCTCCTGATGGGAGTCATCATCACCTACCTCATGGCCGTCCATTACGGCGGTCAGATCTCCCCCTGGTCATCG
CCGCCTGTCGTCGGCCTCTTGGTCGGCTCTTTCGTCCTGGCCCTCGCCTTCGCGCTGTGCGAGTATTGGCAGGGA
GACCGAGCCATCGTCATCCCTCGCCTCTTATCGCAAAGACGCATCGGCCTTTCGGCCGTCTTCACCATCCTTCAA
TCCGGCGCCTTCTTCTCCATGATCTACTATCTCCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTCGTC
TCTGGCGTACAGAACCTGCCCTTTATCCTGGCCGCCATGCTGGGCGCCCTCGGGGCCGGCGTCTTCATCTCCAGC
ACCGGCATGTCGACGCTCGTCATGGTAGCCGGTACGGCCTTGGGCACGCTCGGCTGCGGCCTCTGTTACATGTTT
GACGTCAACACATCGAGCGGCACCTGGATAGGCTTCCAGATAATCGCAGGCGTGAGTCTCGGCGCCGCGCTTCAG
ATCCCCGTCATCGTGGGCCAGGTCAGCGTCCAGCCCCGAGACCTGTCATCAGCCACGTCCATGATGCTCTGCTTC
CAGACGCTGGGGGGCGCAATCTGGACCTCTGCCGCGCAGTCAGCCTTTGTCAACCGAATGATGGCCACGTTACCC
GAGTTGGCGCCTGGCATCGACCCGATGAAGGTCGTGGCTACGGGGGCCGGACAGTTGCGCGGCGTCTTTGCTGCG
GGAGAACTGGACGGTGTCTTGGCCGCTTACCTCGAGGGCATCAGGACGGCTTTTATCCTTTCCTGCGCCATCGCG
GGTGGTGCCTGTATCTTGGGCGTGTTTCTGCCCTGGAAGAGGCTTGACGTGGTTGCGGTGAGAGAGAACTCGGGA
GGTGGATAA
Transcript >Ophcf2|02403
ATGCCTAGACCTGTCCGGCAACCTCCCCGGGAAGGGGAGTCGACGTCACGGCCCATCAGCGGCATCTTGTCGCCA
TGGCGCTTCTCGACCATCGGCTCCGATGAGCTCTCCGTCTTCAGCCCGCTCGAGGAGACGCACATCACGGCCCTC
GACTTCGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGCTGCCAGTAATGCAGAGCTCGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGCTCGTTGACTGAGTCGCCTGTCGATGCGTCG
GGTACGGACGCGCATTCCATAAGCTCCTGGAATCTCCATCACGGCGAGGATCCCACCGCGGAGCCGGAGCCGGAG
CCCGAGTACCCTACCGGATTCACTCTATGGATCATGATAGCAGCCCTCATCTCTAGCATCTTTCTCATCGCTCTA
GACATGGCAAACGAGTTCCACGGCCTTCAAGACGTAGCCTGGTACAGCGCCATCTTCTTCATGACCGCCGGCGGC
TTCCAATCAACTTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAAGTCGGCGTCCTGACGGCCATTTCCATCTTC
GAAGCGGGAAACCTCATCTGCGGAGTGGCGCCCAGCTCCTCCGTCTTCATCGTCGGCCGTGCCATCGCAGGCGTC
GGAGCAGCGGGCGTCGGATCCGGCTCGTACACCCTCGTTGCCTTCATCGCCGAGCCTGAGAAGAGAGCGGCTTAT
ACCGGTCTTCTCGGGGCCATCTTCGGCATCGGGAGTGTGCTGGGTCCGCTTCTGGGCGGTGTGTTCTCCAGTAGG
AGCACGTGGAGATGGTGCTTTTACATCAACCTCCCGATAGGCGTGCTCCCCGTCATCACCCTGGTGTTCTTCTTC
CGCCCTCCCGCGACGGCAAAGCCTCAAGAAGCGCCCCTGAGAGAGAAGCTATTAGGGATGGATCCGCTCGGCACA
TGTCTCCTGATGGGAGTCATCATCACCTACCTCATGGCCGTCCATTACGGCGGTCAGATCTCCCCCTGGTCATCG
CCGCCTGTCGTCGGCCTCTTGGTCGGCTCTTTCGTCCTGGCCCTCGCCTTCGCGCTGTGCGAGTATTGGCAGGGA
GACCGAGCCATCGTCATCCCTCGCCTCTTATCGCAAAGACGCATCGGCCTTTCGGCCGTCTTCACCATCCTTCAA
TCCGGCGCCTTCTTCTCCATGATCTACTATCTCCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTCGTC
TCTGGCGTACAGAACCTGCCCTTTATCCTGGCCGCCATGCTGGGCGCCCTCGGGGCCGGCGTCTTCATCTCCAGC
ACCGGCATGTCGACGCTCGTCATGGTAGCCGGTACGGCCTTGGGCACGCTCGGCTGCGGCCTCTGTTACATGTTT
GACGTCAACACATCGAGCGGCACCTGGATAGGCTTCCAGATAATCGCAGGCGTGAGTCTCGGCGCCGCGCTTCAG
ATCCCCGTCATCGTGGGCCAGGTCAGCGTCCAGCCCCGAGACCTGTCATCAGCCACGTCCATGATGCTCTGCTTC
CAGACGCTGGGGGGCGCAATCTGGACCTCTGCCGCGCAGTCAGCCTTTGTCAACCGAATGATGGCCACGTTACCC
GAGTTGGCGCCTGGCATCGACCCGATGAAGGTCGTGGCTACGGGGGCCGGACAGTTGCGCGGCGTCTTTGCTGCG
GGAGAACTGGACGGTGTCTTGGCCGCTTACCTCGAGGGCATCAGGACGGCTTTTATCCTTTCCTGCGCCATCGCG
GGTGGTGCCTGTATCTTGGGCGTGTTTCTGCCCTGGAAGAGGCTTGACGTGGTTGCGGTGAGAGAGAACTCGGGA
GGTGGATAA
Gene >Ophcf2|02403
ATGCCTAGACCTGTCCGGCAACCTCCCCGGGAAGGGGAGTCGACGTCACGGCCCATCAGCGGCATCTTGTCGCCA
TGGCGCTTCTCGACCATCGGCTCCGATGAGCTCTCCGTCTTCAGCCCGCTCGAGGAGACGCACATCACGGCCCTC
GACTTCGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGCTGCCAGTAATGCAGAGCTCGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGCTCGTTGACTGAGTCGCCTGTCGATGCGTCG
GGTACGGACGCGCATTCCATAAGCTCCTGGAATCTCCATCACGGCGAGGATCCCACCGCGGAGCCGGAGCCGGAG
CCCGAGTACCCTACCGGATTCACTCTATGGATCATGATAGCAGCCCTCATCTCTAGCATCTTTCTCATCGCTCTA
GACATGGCAAGTCGCAGACTAGATACCCCATAGACACGGTTCCATCACCCCTAACCTCTACAGACCATCGTCGCC
ACGGCCGTTCCCGCCATCACAGACGAGTTCCACGGCCTTCAAGACGTAGCCTGGTACAGCGCCATCTTCTTCATG
ACCGCCGGCGGCTTCCAATCAACTTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAAGTCGGCGTCCTGACGGCC
ATTTCCATCTTCGAAGCGGGAAACCTCATCTGCGGAGTGGCGCCCAGCTCCTCCGTCTTCATCGTCGGCCGTGCC
ATCGCAGGCGTCGGAGCAGCGGGCGTCGGATCCGGCTCGTACACCCTCGTTGCCTTCATCGCCGAGCCTGAGAAG
AGAGCGGCTTATACCGGTCTTCTCGGGGCCATCTTCGGCATCGGGAGTGTGCTGGGTCCGCTTCTGGGCGGTGTG
TTCTCCAGTAGGAGCACGTGGAGATGGTGAGTGTCTTGATCGGATCTCTTTTCGAGAGAGATGAGAGCTCAATCC
TTCCAGGTGCTTTTACATCAACCTCCCGATAGGCGTGCTCCCCGTCATCACCCTGGTGTTCTTCTTCCGCCCTCC
CGCGACGGCAAAGCCTCAAGAAGCGCCCCTGAGAGAGAAGCTATTAGGGATGGATCCGCTCGGCACATGTCTCCT
GATGGGAGTCATCATCACCTACCTCATGGCCGTCCATTACGGCGGTCAGATCTCCCCCTGGTCATCGCCGCCTGT
CGTCGGCCTCTTGGTCGGCTCTTTCGTCCTGGCCCTCGCCTTCGCGCTGTGCGAGTATTGGCAGGGAGACCGAGC
CATCGTCATCCCTCGCCTCTTATCGCAAAGACGCATCGGCCTTTCGGCCGTCTTCACCATCCTTCAATCCGGCGC
CTTCTTCTCCATGATCTACTATCTCCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTCGTCTCTGGCGT
ACAGAACCTGCCCTTTATCCTGGCCGCCATGCTGGGCGCCCTCGGGGCCGGCGTCTTCATCTCCAGCACCGGCAT
GTCGACGCTCGTCATGGTAGCCGGTACGGCCTTGGGCACGCTCGGCTGCGGCCTCTGTTACATGTTTGACGTCAA
CACATCGAGCGGCACCTGGATAGGCTTCCAGATAATCGCAGGCGTGAGTCTCGGCGCCGCGCTTCAGATCCCCGT
CATCGTGGGCCAGGTCAGCGTCCAGCCCCGAGACCTGTCATCAGCCACGTCCATGATGCTCTGCTTCCAGACGCT
GGGGGGCGCAATCTGGACCTCTGCCGCGCAGTCAGCCTTTGTCAACCGAATGATGGCCACGTTACCCGAGTTGGC
GCCTGGCATCGACCCGATGAAGGTCGTGGCTACGGGGGCCGGACAGTTGCGCGGCGTCTTTGCTGCGGGAGAACT
GGACGGTGTCTTGGCCGCTTACCTCGAGGGCATCAGGACGGCTTTTATCCTTTCCTGCGCCATCGCGGGTGGTGC
CTGTATCTTGGGCGTGTTTCTGCCCTGGAAGAGGCTTGACGTGGTTGCGGTGAGAGAGAACTCGGGAGGTGGATA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail