Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02387
Gene name
Locationscaffold_02:3517488..3523474
Strand+
Gene length (bp)5986
Transcript length (bp)4479
Coding sequence length (bp)4479
Protein length (aa) 1493

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 1.2E-13 1313 1421
PF01841 Transglut_core Transglutaminase-like superfamily 1.1E-09 1249 1332
PF00400 WD40 WD domain, G-beta repeat 6.5E-02 267 297

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6736 0.665 0.1763 0.0572 0.1648 0.1801 0.1698 0.2857 0.2351 0.0833

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup785
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5361
Ophiocordyceps australis map64 (Brazil) OphauB2|7847
Ophiocordyceps camponoti-floridani Ophcf2|02387 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|833
Ophiocordyceps kimflemingae Ophio5|1144
Ophiocordyceps kimflemingae Ophio5|1955
Ophiocordyceps subramaniannii Hirsu2|3041

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02387
MDIHRCRFVPYQPAAINAVAFSHPKPRSTVHGSIARLAVGRSNGDIEIWNPASGAWHQELIIRGGKDRSIDSLVW
VNEPDQDMGHGRAIVGKCRLFSIGYTSTITEWDLEKGRVKRHASGQHGDIWCMAAQPLASASTSDCGNQPSTKIV
AGTMHGDLAVYSADDDDLRFQRLMVKSPTKKVQMISIAFQSHKVCVVGCSDSTIRVYDVTNGHMLRRMTLGSDLV
GGTKNIIVWCVRCLPNENIVSGDSTGQICIWNGKTYTQKQRIDGHTQDVLSLAISADGTSIISGGMDRKTVLYKP
NAGSSHRWNKVLSRRFHEHDVKAMAPFEYGNMSVVISGGQDANLMVIPLKAMGQENQRAMSYLPHQPPVASASQC
RFMVGWWDRQVHVWVLRKTASDLLTSAEDALDVKQNRKLLKSIVIRGDSNITSASIDEKGSLLVVATATDVKAFH
LRHRDPVKPSDVTVTSLKLPQDMTYLGASQVKLSPDGEWLCLVQEGAVILMASIDRDGQDSPTISVKYQRLSRLH
RDIPHFITNGGLGKYQRNITQVAFSADSRMLAVADLAGYLDSWSLCRGGDDEHNADGGDEEYNADGGEDEHNADG
GEDEHNADGGVADDHTSSSSSSSSSSSSSSSFDSGDEQLQAESGWIRNVTAKQIPKLSSAPVVLSFSSHVPVHDD
DADDYVLVAVTSSWHVYTFHPRLGALTPWSRRHPRSALPPQIRDIRDLPKGILWQGPRMWVYGVSFLLMIDLSQD
LRVAADSSSTAQGRKRKRNGPSSGAGNLNEKYSLAPSKICKHQRNGRYEVVTVGEASREKESDSDTEFSDADGGV
TDYEPMDGAGEDAKGGDKGKAMDGEEVQATDSRHEKTTGSKKVLATNSNAKGRQWWLTFKYRPVLGIVSLNQNDD
STLEVALVERPSWDREMPERYFAAHELERTCGMGLASGETAAWMSNTRNKRLTQRLFTIDAAVPYLNSGCRSASP
ELRLHSFASSPAFCFLRIFRPPPPPSPISLRLYSYSPSVQFPSDCPSHLPVPFAASLTMAGRGIPPSPDQASSQA
RHGDEWAHDLRIRFEGLLRDKRMTDLRSSPRHLSPGLISRASSANLYGHVPVDHGRPATSHGQPTPPSYSCLRHL
PKIPTPPAVSDKDSQKFRNLLISLSLTPTKYENPGLLDEALQIIPLDRIYSEAEEESQVLQAEAESMGDGRRPEW
GYQDCVIRALLRWFKRSFFTWVNNPPCPVCLSPTFAHGMTAPTPEESACGALRVELYRCSAHGCGAFERFPRYGD
VWRLLQTRRGRVGEWANCFSMLCRAVGGRVRWVWNAEDHVWTEVYSEHRQRWVHVDACEESWDNPRLYSEGWGKK
MSYCIAFSIEGATDVTRRYVRKSEYANERSRCPEEVLLYVMQEIKGLRRATMGKEERFRLEKEDGREDQELRGYV
VASIAQAVTDLVPGSSGSSPTRRSESADVKVPTDQPGRQPASAEWLAAQQQARGRQPQPPRDPGRGG*
Coding >Ophcf2|02387
ATGGACATCCATCGCTGCCGCTTCGTGCCCTACCAGCCCGCGGCCATCAATGCAGTCGCCTTCTCGCACCCCAAG
CCGCGGTCCACTGTCCACGGTTCCATCGCGCGTTTGGCAGTCGGGCGCTCCAACGGCGATATCGAAATTTGGAAC
CCCGCGTCCGGCGCATGGCATCAAGAGCTCATCATCCGCGGCGGAAAGGACCGAAGCATCGACAGCCTCGTCTGG
GTCAACGAGCCTGACCAGGACATGGGCCATGGCCGCGCCATCGTTGGGAAATGTCGCCTCTTCAGCATCGGCTAC
ACCTCGACCATCACTGAGTGGGACCTCGAAAAGGGCAGGGTGAAAAGGCACGCCAGTGGTCAGCACGGAGACATC
TGGTGCATGGCCGCTCAACCTCTCGCCTCGGCATCGACGTCCGACTGTGGCAACCAGCCCTCCACCAAGATCGTC
GCCGGCACTATGCACGGCGACCTGGCTGTGTACTCGGCTGACGACGACGATCTGCGTTTCCAGCGCTTGATGGTT
AAATCGCCGACGAAGAAGGTGCAAATGATCAGTATCGCGTTCCAATCTCACAAAGTCTGTGTGGTCGGCTGCTCT
GATAGCACAATCCGAGTGTACGATGTCACCAACGGCCACATGCTTCGACGCATGACACTCGGGTCTGACCTGGTC
GGCGGAACTAAGAACATCATCGTCTGGTGCGTCAGGTGCCTGCCCAACGAGAATATCGTCTCCGGCGATTCGACG
GGCCAGATCTGCATCTGGAACGGAAAGACGTACACTCAAAAGCAACGAATCGATGGCCACACGCAGGATGTTCTC
AGCCTCGCCATTAGCGCCGACGGGACCAGCATCATAAGCGGAGGCATGGATCGAAAGACTGTGCTTTACAAGCCC
AATGCAGGCTCTTCTCATCGCTGGAACAAAGTGCTGTCGCGACGCTTTCACGAACACGACGTCAAGGCCATGGCC
CCGTTCGAATACGGAAACATGAGCGTGGTTATCTCTGGAGGCCAGGACGCCAACTTGATGGTCATACCCCTCAAA
GCAATGGGCCAAGAGAATCAAAGAGCGATGAGCTACCTCCCGCACCAGCCTCCCGTCGCCAGCGCTTCTCAGTGC
CGATTCATGGTGGGCTGGTGGGACCGACAAGTTCACGTTTGGGTATTGAGGAAGACCGCTTCAGATCTCCTCACC
TCGGCCGAGGACGCCTTGGACGTCAAACAAAACCGAAAGCTTCTCAAGTCTATTGTCATCCGGGGTGACTCCAAC
ATCACCTCTGCTTCCATCGATGAAAAGGGCAGCTTACTCGTCGTGGCGACGGCGACAGACGTAAAGGCCTTTCAC
CTGAGGCACCGGGATCCAGTCAAGCCATCAGATGTCACGGTTACTTCTTTGAAGCTTCCGCAAGATATGACCTAC
CTGGGGGCCAGTCAGGTCAAGCTATCGCCCGACGGCGAGTGGCTGTGCTTGGTTCAAGAAGGCGCCGTTATCCTG
ATGGCGAGCATCGACCGCGACGGACAAGACTCACCAACCATCTCGGTCAAATATCAGCGGCTATCCCGCCTTCAC
CGCGATATTCCCCACTTCATCACGAACGGCGGCCTGGGGAAGTACCAGAGGAACATCACACAGGTGGCCTTCAGT
GCGGATTCGCGCATGCTGGCGGTGGCTGATTTGGCTGGCTACCTGGACTCATGGAGTCTGTGCCGCGGTGGAGAC
GATGAGCACAATGCCGACGGTGGAGATGAAGAGTACAATGCCGACGGTGGAGAGGACGAGCACAATGCCGACGGT
GGAGAGGATGAGCACAATGCCGACGGTGGTGTGGCTGATGATCATACGTCGTCGTCGTCGTCGTCATCATCGTCG
TCGTCGTCGTCGTCGTCATTTGACAGCGGCGACGAACAGCTCCAGGCCGAAAGTGGCTGGATACGCAACGTGACC
GCAAAGCAGATCCCCAAGCTGTCATCGGCGCCTGTCGTGCTGTCTTTCTCGAGCCACGTGCCCGTTCACGACGAT
GATGCCGATGACTACGTGTTGGTAGCCGTGACGTCGTCGTGGCACGTCTACACGTTCCACCCACGTCTTGGCGCG
TTGACGCCGTGGTCGCGTCGGCATCCGCGAAGCGCCCTACCGCCGCAGATCCGTGATATCAGAGACCTGCCGAAA
GGAATACTGTGGCAAGGTCCGAGGATGTGGGTATACGGCGTATCGTTTCTCCTCATGATAGACTTGAGCCAGGAT
CTGCGGGTCGCCGCAGACTCATCATCGACGGCGCAGGGACGGAAACGCAAGAGGAATGGGCCAAGCAGCGGCGCA
GGGAACCTCAACGAGAAGTACAGCCTGGCGCCAAGTAAGATTTGCAAGCACCAACGCAACGGGCGGTACGAAGTG
GTGACCGTGGGCGAAGCCTCTCGAGAGAAGGAAAGCGATAGCGACACAGAGTTCTCCGACGCTGACGGTGGCGTA
ACCGATTACGAGCCCATGGACGGCGCTGGTGAGGATGCGAAAGGCGGCGACAAGGGCAAAGCGATGGACGGCGAA
GAAGTGCAGGCGACGGACAGCAGACACGAGAAGACGACGGGCAGCAAAAAAGTTCTAGCAACAAACAGCAACGCT
AAGGGCAGACAGTGGTGGTTGACGTTCAAGTATCGGCCGGTGCTCGGCATCGTGTCCCTCAACCAGAACGACGAC
TCGACGCTGGAGGTTGCCCTGGTGGAGAGGCCTTCGTGGGACAGGGAGATGCCGGAGCGATACTTTGCCGCCCAC
GAGCTGGAGAGGACGTGTGGCATGGGATTGGCCTCGGGAGAGACGGCAGCGTGGATGAGTAACACGAGGAATAAG
AGGCTTACTCAGAGACTCTTTACGATTGATGCTGCTGTGCCGTACCTGAATAGCGGCTGCAGAAGCGCCTCCCCC
GAACTTCGTCTTCACTCTTTCGCCTCGTCTCCCGCCTTTTGCTTCCTTCGCATTTTCCGACCCCCCCCCCCCCCA
TCCCCCATTTCTCTTCGTCTCTACAGTTACAGCCCTTCCGTCCAGTTTCCCTCCGACTGTCCTTCGCATCTGCCT
GTCCCCTTCGCCGCCTCGCTCACCATGGCGGGACGAGGCATCCCTCCCAGCCCCGACCAAGCGTCCTCCCAGGCG
CGCCATGGTGACGAGTGGGCTCACGACCTGCGTATTCGCTTCGAGGGCCTGTTGCGTGACAAGCGCATGACAGAC
CTGCGATCCAGCCCTCGCCATCTCTCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCCAATCTTTACGGACACGTC
CCCGTCGATCATGGTCGTCCCGCCACATCTCACGGCCAGCCGACGCCTCCGTCCTATTCGTGCCTCCGCCATCTC
CCAAAGATTCCCACTCCTCCTGCCGTCTCCGATAAGGACTCGCAGAAATTTCGCAACCTTCTCATCAGTCTGTCT
TTGACACCCACCAAGTACGAGAACCCGGGCTTGCTGGACGAAGCCCTTCAGATCATACCCCTCGACCGCATCTAT
AGCGAAGCCGAGGAAGAGAGCCAGGTTCTTCAGGCCGAGGCCGAGAGCATGGGCGACGGGCGCCGACCCGAGTGG
GGATATCAGGACTGTGTCATCAGGGCTCTTCTCCGCTGGTTCAAACGATCCTTCTTCACCTGGGTCAACAATCCG
CCCTGCCCCGTGTGCCTGTCACCGACGTTTGCGCACGGAATGACGGCGCCGACGCCGGAAGAGAGTGCGTGCGGT
GCCCTCCGAGTCGAGCTCTACCGCTGCTCCGCCCATGGCTGCGGTGCGTTTGAGCGCTTTCCGCGCTACGGTGAT
GTGTGGCGACTATTACAGACGCGAAGAGGTCGGGTTGGAGAGTGGGCCAACTGCTTCAGCATGCTTTGTCGCGCT
GTTGGCGGACGCGTGCGCTGGGTTTGGAACGCCGAGGATCACGTCTGGACCGAGGTCTATTCCGAGCATCGACAG
CGATGGGTCCATGTCGACGCCTGTGAGGAGTCCTGGGACAATCCGCGCCTTTACAGCGAGGGCTGGGGAAAGAAG
ATGTCTTACTGCATCGCCTTTTCCATCGAGGGGGCCACCGACGTGACGCGACGCTACGTGCGCAAAAGCGAGTAC
GCCAACGAGCGCAGCCGATGCCCGGAAGAGGTGTTGCTGTACGTCATGCAGGAGATCAAGGGCCTCCGCCGCGCC
ACGATGGGCAAGGAAGAGCGCTTCCGTCTCGAAAAGGAGGACGGACGGGAGGACCAGGAGTTGCGGGGATACGTT
GTCGCTTCCATTGCGCAAGCCGTGACGGACCTGGTTCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCGTTCGGAG
TCGGCCGACGTCAAGGTCCCCACCGATCAGCCGGGCCGGCAGCCGGCATCGGCCGAGTGGCTGGCGGCCCAGCAG
CAGGCACGAGGTCGACAGCCTCAACCGCCGCGTGACCCAGGCCGCGGCGGCTGA
Transcript >Ophcf2|02387
ATGGACATCCATCGCTGCCGCTTCGTGCCCTACCAGCCCGCGGCCATCAATGCAGTCGCCTTCTCGCACCCCAAG
CCGCGGTCCACTGTCCACGGTTCCATCGCGCGTTTGGCAGTCGGGCGCTCCAACGGCGATATCGAAATTTGGAAC
CCCGCGTCCGGCGCATGGCATCAAGAGCTCATCATCCGCGGCGGAAAGGACCGAAGCATCGACAGCCTCGTCTGG
GTCAACGAGCCTGACCAGGACATGGGCCATGGCCGCGCCATCGTTGGGAAATGTCGCCTCTTCAGCATCGGCTAC
ACCTCGACCATCACTGAGTGGGACCTCGAAAAGGGCAGGGTGAAAAGGCACGCCAGTGGTCAGCACGGAGACATC
TGGTGCATGGCCGCTCAACCTCTCGCCTCGGCATCGACGTCCGACTGTGGCAACCAGCCCTCCACCAAGATCGTC
GCCGGCACTATGCACGGCGACCTGGCTGTGTACTCGGCTGACGACGACGATCTGCGTTTCCAGCGCTTGATGGTT
AAATCGCCGACGAAGAAGGTGCAAATGATCAGTATCGCGTTCCAATCTCACAAAGTCTGTGTGGTCGGCTGCTCT
GATAGCACAATCCGAGTGTACGATGTCACCAACGGCCACATGCTTCGACGCATGACACTCGGGTCTGACCTGGTC
GGCGGAACTAAGAACATCATCGTCTGGTGCGTCAGGTGCCTGCCCAACGAGAATATCGTCTCCGGCGATTCGACG
GGCCAGATCTGCATCTGGAACGGAAAGACGTACACTCAAAAGCAACGAATCGATGGCCACACGCAGGATGTTCTC
AGCCTCGCCATTAGCGCCGACGGGACCAGCATCATAAGCGGAGGCATGGATCGAAAGACTGTGCTTTACAAGCCC
AATGCAGGCTCTTCTCATCGCTGGAACAAAGTGCTGTCGCGACGCTTTCACGAACACGACGTCAAGGCCATGGCC
CCGTTCGAATACGGAAACATGAGCGTGGTTATCTCTGGAGGCCAGGACGCCAACTTGATGGTCATACCCCTCAAA
GCAATGGGCCAAGAGAATCAAAGAGCGATGAGCTACCTCCCGCACCAGCCTCCCGTCGCCAGCGCTTCTCAGTGC
CGATTCATGGTGGGCTGGTGGGACCGACAAGTTCACGTTTGGGTATTGAGGAAGACCGCTTCAGATCTCCTCACC
TCGGCCGAGGACGCCTTGGACGTCAAACAAAACCGAAAGCTTCTCAAGTCTATTGTCATCCGGGGTGACTCCAAC
ATCACCTCTGCTTCCATCGATGAAAAGGGCAGCTTACTCGTCGTGGCGACGGCGACAGACGTAAAGGCCTTTCAC
CTGAGGCACCGGGATCCAGTCAAGCCATCAGATGTCACGGTTACTTCTTTGAAGCTTCCGCAAGATATGACCTAC
CTGGGGGCCAGTCAGGTCAAGCTATCGCCCGACGGCGAGTGGCTGTGCTTGGTTCAAGAAGGCGCCGTTATCCTG
ATGGCGAGCATCGACCGCGACGGACAAGACTCACCAACCATCTCGGTCAAATATCAGCGGCTATCCCGCCTTCAC
CGCGATATTCCCCACTTCATCACGAACGGCGGCCTGGGGAAGTACCAGAGGAACATCACACAGGTGGCCTTCAGT
GCGGATTCGCGCATGCTGGCGGTGGCTGATTTGGCTGGCTACCTGGACTCATGGAGTCTGTGCCGCGGTGGAGAC
GATGAGCACAATGCCGACGGTGGAGATGAAGAGTACAATGCCGACGGTGGAGAGGACGAGCACAATGCCGACGGT
GGAGAGGATGAGCACAATGCCGACGGTGGTGTGGCTGATGATCATACGTCGTCGTCGTCGTCGTCATCATCGTCG
TCGTCGTCGTCGTCGTCATTTGACAGCGGCGACGAACAGCTCCAGGCCGAAAGTGGCTGGATACGCAACGTGACC
GCAAAGCAGATCCCCAAGCTGTCATCGGCGCCTGTCGTGCTGTCTTTCTCGAGCCACGTGCCCGTTCACGACGAT
GATGCCGATGACTACGTGTTGGTAGCCGTGACGTCGTCGTGGCACGTCTACACGTTCCACCCACGTCTTGGCGCG
TTGACGCCGTGGTCGCGTCGGCATCCGCGAAGCGCCCTACCGCCGCAGATCCGTGATATCAGAGACCTGCCGAAA
GGAATACTGTGGCAAGGTCCGAGGATGTGGGTATACGGCGTATCGTTTCTCCTCATGATAGACTTGAGCCAGGAT
CTGCGGGTCGCCGCAGACTCATCATCGACGGCGCAGGGACGGAAACGCAAGAGGAATGGGCCAAGCAGCGGCGCA
GGGAACCTCAACGAGAAGTACAGCCTGGCGCCAAGTAAGATTTGCAAGCACCAACGCAACGGGCGGTACGAAGTG
GTGACCGTGGGCGAAGCCTCTCGAGAGAAGGAAAGCGATAGCGACACAGAGTTCTCCGACGCTGACGGTGGCGTA
ACCGATTACGAGCCCATGGACGGCGCTGGTGAGGATGCGAAAGGCGGCGACAAGGGCAAAGCGATGGACGGCGAA
GAAGTGCAGGCGACGGACAGCAGACACGAGAAGACGACGGGCAGCAAAAAAGTTCTAGCAACAAACAGCAACGCT
AAGGGCAGACAGTGGTGGTTGACGTTCAAGTATCGGCCGGTGCTCGGCATCGTGTCCCTCAACCAGAACGACGAC
TCGACGCTGGAGGTTGCCCTGGTGGAGAGGCCTTCGTGGGACAGGGAGATGCCGGAGCGATACTTTGCCGCCCAC
GAGCTGGAGAGGACGTGTGGCATGGGATTGGCCTCGGGAGAGACGGCAGCGTGGATGAGTAACACGAGGAATAAG
AGGCTTACTCAGAGACTCTTTACGATTGATGCTGCTGTGCCGTACCTGAATAGCGGCTGCAGAAGCGCCTCCCCC
GAACTTCGTCTTCACTCTTTCGCCTCGTCTCCCGCCTTTTGCTTCCTTCGCATTTTCCGACCCCCCCCCCCCCCA
TCCCCCATTTCTCTTCGTCTCTACAGTTACAGCCCTTCCGTCCAGTTTCCCTCCGACTGTCCTTCGCATCTGCCT
GTCCCCTTCGCCGCCTCGCTCACCATGGCGGGACGAGGCATCCCTCCCAGCCCCGACCAAGCGTCCTCCCAGGCG
CGCCATGGTGACGAGTGGGCTCACGACCTGCGTATTCGCTTCGAGGGCCTGTTGCGTGACAAGCGCATGACAGAC
CTGCGATCCAGCCCTCGCCATCTCTCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCCAATCTTTACGGACACGTC
CCCGTCGATCATGGTCGTCCCGCCACATCTCACGGCCAGCCGACGCCTCCGTCCTATTCGTGCCTCCGCCATCTC
CCAAAGATTCCCACTCCTCCTGCCGTCTCCGATAAGGACTCGCAGAAATTTCGCAACCTTCTCATCAGTCTGTCT
TTGACACCCACCAAGTACGAGAACCCGGGCTTGCTGGACGAAGCCCTTCAGATCATACCCCTCGACCGCATCTAT
AGCGAAGCCGAGGAAGAGAGCCAGGTTCTTCAGGCCGAGGCCGAGAGCATGGGCGACGGGCGCCGACCCGAGTGG
GGATATCAGGACTGTGTCATCAGGGCTCTTCTCCGCTGGTTCAAACGATCCTTCTTCACCTGGGTCAACAATCCG
CCCTGCCCCGTGTGCCTGTCACCGACGTTTGCGCACGGAATGACGGCGCCGACGCCGGAAGAGAGTGCGTGCGGT
GCCCTCCGAGTCGAGCTCTACCGCTGCTCCGCCCATGGCTGCGGTGCGTTTGAGCGCTTTCCGCGCTACGGTGAT
GTGTGGCGACTATTACAGACGCGAAGAGGTCGGGTTGGAGAGTGGGCCAACTGCTTCAGCATGCTTTGTCGCGCT
GTTGGCGGACGCGTGCGCTGGGTTTGGAACGCCGAGGATCACGTCTGGACCGAGGTCTATTCCGAGCATCGACAG
CGATGGGTCCATGTCGACGCCTGTGAGGAGTCCTGGGACAATCCGCGCCTTTACAGCGAGGGCTGGGGAAAGAAG
ATGTCTTACTGCATCGCCTTTTCCATCGAGGGGGCCACCGACGTGACGCGACGCTACGTGCGCAAAAGCGAGTAC
GCCAACGAGCGCAGCCGATGCCCGGAAGAGGTGTTGCTGTACGTCATGCAGGAGATCAAGGGCCTCCGCCGCGCC
ACGATGGGCAAGGAAGAGCGCTTCCGTCTCGAAAAGGAGGACGGACGGGAGGACCAGGAGTTGCGGGGATACGTT
GTCGCTTCCATTGCGCAAGCCGTGACGGACCTGGTTCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCGTTCGGAG
TCGGCCGACGTCAAGGTCCCCACCGATCAGCCGGGCCGGCAGCCGGCATCGGCCGAGTGGCTGGCGGCCCAGCAG
CAGGCACGAGGTCGACAGCCTCAACCGCCGCGTGACCCAGGCCGCGGCGGCTGA
Gene >Ophcf2|02387
ATGGACATCCATCGCTGCCGCTTCGTGCCCTACCAGCCCGCGGCCATCAATGCAGTCGCCTTCTCGCACCCCAAG
CCGCGGTCCACTGTCCACGGTTCCATCGCGCGTTTGGCAGTCGGGCGCTCCAACGGCGATATCGAAATTTGGAAC
CCCGCGTCCGGCGCATGGCATCAAGAGCTCATCATCCGCGGCGGAAAGGACCGAAGCATCGACAGCCTCGTCTGG
GTCAACGAGCCTGACCAGGACATGGGCCATGGCCGCGCCATCGTTGGGAAATGTCGCCTCTTCAGCATCGGCTAC
ACCTCGACCATCACTGAGTGGGACCTCGAAAAGGGCAGGGTGAAAAGGCACGCCAGTGGTCAGCACGGAGACATC
TGGTGCATGGCCGCTCAACCTCTCGCCTCGGCATCGACGTCCGACTGTGGCAACCAGCCCTCCACCAAGATCGTC
GCCGGCACTATGCACGGCGACCTGGCTGTGTACTCGGCTGACGACGACGATCTGCGTTTCCAGCGCTTGATGGTT
AAATCGCCGACGAAGAAGGTGCAAATGATCAGTATCGCGTTCCAATCTCACAAAGTCTGTGTGGTCGGCTGCTCT
GATAGCACAATCCGAGTGTACGATGTCACCAACGGCCACATGCTTCGACGCATGACACTCGGGTCTGACCTGGTC
GGCGGAACTAAGAACATCATCGTCTGGTGCGTCAGGTGCCTGCCCAACGAGAATATCGTCTCCGGCGATTCGACG
GGCCAGATCTGCATCTGGAACGGAAAGACGTACACTCAAAAGCAACGAATCGATGGCCACACGCAGGATGTTCTC
AGCCTCGCCATTAGCGCCGACGGGACCAGCATCATAAGCGGAGGCATGGATCGAAAGACTGTGCTTTACAAGCCC
AATGCAGGCTCTTCTCATCGCTGGAACAAAGTGCTGTCGCGACGCTTTCACGAACACGACGTCAAGGCCATGGCC
CCGTTCGAATACGGAAACATGAGCGTGGTTATCTCTGGAGGTAAAATCTCCTCACCCGTCAACTTGAAGCGTCAC
TAACATCAGGCTTATAGGCCAGGACGCCAACTTGATGGTCATACCCCTCAAAGCAATGGGCCAAGAGAATCAAAG
AGCGATGAGCTACCTCCCGCACCAGCCTCCCGTCGCCAGCGCTTCTCAGTGCCGATTCATGGTGGGCTGGTGGGA
CCGACAAGTTCACGTTTGGGTATTGAGGAAGACCGCTTCAGATCTCCTCACCTCGGCCGAGGACGCCTTGGACGT
CAAACAAAACCGAAAGCTTCTCAAGTCTATTGTCATCCGGGGTGACTCCAACATCACCTCTGCTTCCATCGATGA
AAAGGGCAGCTTACTCGTCGTGGCGACGGCGACAGACGTAAAGGCCTTTCACCTGAGGCACCGGGATCCAGTCAA
GCCATCAGATGTCACGGTTACTTCTTTGAAGCTTCCGCAAGATATGACCTACCTGGGGGCCAGTCAGGTCAAGCT
ATCGCCCGACGGCGAGTGGCTGTGCTTGGTTCAAGAAGGCGCCGTTATCCTGATGGCGAGCATCGACCGCGACGG
ACAAGACTCACCAACCATCTCGGTCAAATATCAGCGGCTATCCCGCCTTCACCGCGATATTCCCCACTTCATCAC
GAACGGCGGCCTGGGGAAGTACCAGAGGAACATCACACAGGTGGCCTTCAGTGCGGATTCGCGCATGCTGGCGGT
GGCTGATTTGGCTGGCTACCTGGACTCATGGAGTCTGTGCCGCGGTGGAGACGATGAGCACAATGCCGACGGTGG
AGATGAAGAGTACAATGCCGACGGTGGAGAGGACGAGCACAATGCCGACGGTGGAGAGGATGAGCACAATGCCGA
CGGTGGTGTGGCTGATGATCATACGTCGTCGTCGTCGTCGTCATCATCGTCGTCGTCGTCGTCGTCGTCATTTGA
CAGCGGCGACGAACAGCTCCAGGCCGAAAGTGGCTGGATACGCAACGTGACCGCAAAGCAGATCCCCAAGCTGTC
ATCGGCGCCTGTCGTGCTGTCTTTCTCGAGCCACGTGCCCGTTCACGACGATGATGCCGATGACTACGTGTTGGT
AGCCGTGACGTCGTCGTGGCACGTCTACACGTTCCACCCACGTCTTGGCGCGTTGACGCCGTGGTCGCGTCGGCA
TCCGCGAAGCGCCCTACCGCCGCAGATCCGTGATATCAGAGACCTGCCGAAAGGAATACTGTGGCAAGGTCCGAG
GATGTGGGTATACGGCGTATCGTTTCTCCTCATGATAGACTTGAGCCAGGATCTGCGGGTCGCCGCAGACTCATC
ATCGACGGCGCAGGGACGGAAACGCAAGAGGAATGGGCCAAGCAGCGGCGCAGGGAACCTCAACGAGAAGTACAG
CCTGGCGCCAAGTAAGATTTGCAAGCACCAACGCAACGGGCGGTACGAAGTGGTGACCGTGGGCGAAGCCTCTCG
AGAGAAGGAAAGCGATAGCGACACAGAGTTCTCCGACGCTGACGGTGGCGTAACCGATTACGAGCCCATGGACGG
CGCTGGTGAGGATGCGAAAGGCGGCGACAAGGGCAAAGCGATGGACGGCGAAGAAGTGCAGGCGACGGACAGCAG
ACACGAGAAGACGACGGGCAGCAAAAAAGTTCTAGCAACAAACAGCAACGCTAAGGGCAGACAGTGGTGGTTGAC
GTTCAAGTATCGGCCGGTGCTCGGCATCGTGTCCCTCAACCAGAACGACGACTCGACGCTGGAGGTTGCCCTGGT
GGAGAGGCCTTCGTGGGACAGGGAGATGCCGGAGCGATACTTTGCCGCCCACGAGCTGGAGAGGTGAAGTGTCAG
AGGCCGCGCAATCTCGACGGGTAGGCGAGGATGGCTCACGCCTCGGTGCCTTGAGTACGGTGGTGACCTCGTCCC
CTTGGACCATTCGCCCGGATGCCTCGCCCCCTCGAGTTTCAATATTGGCTGCCAGTCACAAGGCGAATTGGTCGC
TCACAGGACGTGTGGCATGGGATTGGCCTCGGGAGAGACGGCAGCGTGGATGAGTAACACGAGGAATAAGAGGCT
TACTCAGGTGAGAGCATGCAACGTTGGATAGTGAGATGGCTTTGTCTCTCGCTCCACCAACGGCGAGGGCGGTGA
CTGGTTTTACGCAACGTCGATAACCAAGGGCCGAAGATACTTGTGGCTAGGAGAGAAAGGCAGATGACGTGTCGC
TCACAGGTGTAAGATGGCATGAAGCCGGTGAAAGACGGAGGTGAGTCTGCTGAGGACAAGGGGAAACCACGGGGC
TTTTTCAGGTGGGCGCGGGGACCATGTGTGCATTATTGGGCGCGCCAGGACGAGGCTCTATGGGAGCAGGGGGGG
GGGGGGGGAGGAGGGTTTGCATAGTTGCCTATTCGTAGGAGGACAGAGATGACGCGTCCTGGAAATAGAAGAGCG
GTTCAAACATGAGGCTAATGAGAAACGAGGCTGATGTCGGGATGTGGCGGCTATTTGACTGCGCCACAGCAAGAC
GGGACGAAAGGCAAAGGGCGACAAATGCTGACCAGGCGGCTAATGAAGGTTGTTGGTACAGTGTACTTCGTAGCC
GCTCCTCATTGATATAAGAGTACGAAAATGGCAGTGCCTATTCGTCGGTAAATTAGGTAGTCATTGTCGCTCGTC
GACGTGGTCATAGCCTTTCACGGCCAGAGCCCAAGCTGGAGGCATCTCGTTATTTCGCGCCTCTTATCGGGGTTC
GCCGTCGCTGTCGCCGTCGTTGTCGTCGTCGTCACGAGACATGGTACCTACCTAGGTACATACATATGATCAAGG
ATGATAGCGCGCATGTACACAGAACTAGCTTTACAACCATTACTCACGCGACCCAGCCGGTAGCCGTTACCAACG
GCCCTCCGCCGGCGTTTTACCTCTCCTCGGCCCCTCCACTCTCCACCCTGCCACCCCTCCTCTGCTATCCAGCCA
ATCGCGGCTCTCCCCGCCATGATACCCGGACCCTGATTGGCCACTGCGACGCAGGCTGACGCGTAAACCGGCCAT
CCAACGATGGCCCCTGGTCCATCCATCCTCGACTCTCTTTCTCGCCGCAATTCGAAGACGGACAGAGACTCTTTA
CGATTGATGCTGCTGTGCCGTACCTGAATAGCGGCTGCAGAAGCGCCTCCCCCGAACTTCGTCTTCACTCTTTCG
CCTCGTCTCCCGCCTTTTGCTTCCTTCGGTTTGTCGTCTCCTCTCTTCTCTCTTTCTCTCTCTCTCCCAACCCTC
CATCGGCAGCAGCAGCAGCTTTGAACTCGATCAGACGTCTCTGCTCTGGCCGTCCTTGGAGGCATCCTCCGTCTG
TCGACTTGGGACGGGGAAAAGGGATCCATCTAGTTGCATCTCCCAGGGCTGACGACGACTGTTTATAGCATTTTC
CGACCCCCCCCCCCCCCATCCCCCATTTCTCTTCGTCTCTACAGTTACAGCCCTTCCGTCCAGTTTCCCTCCGAC
TGTCCTTCGCATCTGCCTGTCCCCTTCGCCGCCTCGCTCACCATGGCGGGACGAGGCATCCCTCCCAGCCCCGAC
CAAGCGTCCTCCCAGGCGCGCCATGGTGACGAGTGGGCTCACGACCTGCGTATTCGCTTCGAGGGCCTGTTGCGT
GACAAGCGCATGACAGACCTGCGATCCAGCCCTCGCCATCTCTCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCC
AATCTTTACGGACACGTCCCCGTCGATCATGGTCGTCCCGCCACATCTCACGGCCAGCCGACGCCTCCGTCCTAT
TCGTGCCTCCGCCATCTCCCAAAGATTCCCACTCCTCCTGCCGTCTCCGATAAGGACTCGCAGAAATTTCGCAAC
CTTCTCATCAGTCTGTCTTTGACACCCACCAAGTACGAGAACCCGGGCTTGCTGGACGAAGCCCTTCAGATCATA
CCCCTCGACCGCATCTATAGCGAAGCCGAGGAAGAGAGCCAGGTTCTTCAGGCCGAGGCCGAGAGCATGGGCGAC
GGGCGCCGACCCGAGTGGGGATATCAGGACTGTGTCATCAGGGCTCTTCTCCGGTACGCTGTCCTTGTCGTTTCC
AGTTGTATTCGAGCCTTGACTGAAGCCTCTTGTTCTTTGCAGCTGGTTCAAACGATCCTTCTTCACCTGGGTCAA
CAATCCGCCCTGCCCCGTGTGCCTGTCACCGACGTTTGCGCACGGAATGACGGCGCCGACGCCGGAAGAGAGTGC
GTGCGGTGCCCTCCGAGTCGAGCTCTACCGCTGCTCCGCCCATGGCTGCGGTGCGTTTGAGCGCTTTCCGCGCTA
CGGTGATGTGTGGCGACTATTACAGACGCGAAGAGGTCGGGTTGGAGAGTGGGCCAACTGCTTCAGCATGCTTTG
TCGCGCTGTTGGCGGACGCGTGCGCTGGGTTTGGAACGCCGAGGATCACGTCTGGACCGAGGTCTATTCCGAGCA
TCGACAGCGATGGGTCCATGTCGACGCCTGTGAGGAGTCCTGGGACAATCCGCGCCTTTACAGCGAGGGCTGGGG
AAAGAAGATGTCTTACTGCATCGCCTTTTCCATCGAGGGGGCCACCGACGTGACGCGACGCTACGTGCGCAAAAG
CGAGTACGCCAACGAGCGCAGCCGATGCCCGGAAGAGGTGTTGCTGTACGTCATGCAGGAGATCAAGGGCCTCCG
CCGCGCCACGATGGGCAAGGAAGAGCGCTTCCGTCTCGAAAAGGAGGACGGACGGGAGGACCAGGAGTTGCGGGG
ATACGTTGTCGCTTCCATTGCGCAAGCCGTGACGGACCTGGTTCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCG
TTCGGAGTCGGCCGACGTCAAGGTCCCCACCGATCAGCCGGGCCGGCAGCCGGCATCGGCCGAGTGGCTGGCGGC
CCAGCAGCAGGCACGAGGTCGACAGCCTCAACCGCCGCGTGACCCAGGCCGCGGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail