Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02386
Gene name
Locationscaffold_02:3515601..3517090
Strand-
Gene length (bp)1489
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04095 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase) family 3.0E-47 179 437
PF17767 NAPRTase_N Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain 2.3E-41 17 145

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8487 0.4896 0.1388 0.0584 0.1326 0.1131 0.0522 0.1372 0.0326 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5363
Ophiocordyceps australis map64 (Brazil) OphauB2|7849
Ophiocordyceps camponoti-floridani Ophcf2|02386 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|831
Ophiocordyceps kimflemingae Ophio5|1953
Ophiocordyceps subramaniannii Hirsu2|7715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02386
MNSDSSPPPLVGIESILDTDLYKLTMQCAVFRFFKDVPVTYAFTNRTPDKKFSRAAFEWLDEQVQKLANVSLSED
EYTFLESKCSYFTADYLEYLRNFRLRPSEEVSMTFTPIGTKSDVGDIDIQITGSWSGTILYEIPLLALVSEAYFR
FMDTDWNYDGQEEQAYAKGIQLLEAGCLTSEFGTRRRRDYRTQALVLRGLVRASNEAATKGLPGKLVGTSNVHLA
MRFGLTPIGTVAHEWFMGTASIIDDYQKATEEALRHWIGCFGSSLTIALTDTFGTPEFLKAFSLPIRPVEGCFVP
DFFRKSDGAYKTYAELFDGVRQDSGDPAEYTKTMRSYYDEQGIKDKKKIIFSDSLNIERCLEYKRISEECGLQPS
FGVGTFLSNDFVRLSTGAKSTPLNIVIKLSSAAGRPAIKISDTVGKNTGDKNVVERVKRELGYVERHWEEGDEST
RWGKEEPARR*
Coding >Ophcf2|02386
ATGAACTCGGACAGCTCACCGCCCCCGCTCGTCGGGATCGAATCCATCCTCGACACCGATCTGTACAAGTTGACG
ATGCAATGTGCTGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAATCGCACTCCCGACAAG
AAGTTCTCTCGCGCCGCTTTCGAATGGCTTGACGAGCAGGTACAGAAACTGGCCAACGTTTCTCTCTCCGAAGAC
GAATATACCTTTCTGGAATCAAAATGCAGCTACTTCACCGCCGACTATCTCGAGTATCTGCGAAACTTTCGGCTG
CGGCCGAGCGAGGAGGTTTCGATGACGTTTACACCTATCGGTACCAAATCAGACGTGGGAGATATCGACATTCAA
ATCACAGGATCCTGGTCCGGCACGATTCTCTATGAGATCCCGCTTCTTGCGCTCGTATCAGAGGCCTACTTTCGT
TTCATGGACACGGACTGGAACTATGACGGTCAGGAGGAACAGGCATACGCCAAGGGCATTCAGCTTCTGGAAGCG
GGCTGCCTTACATCCGAGTTTGGCACGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTA
GTGAGGGCATCCAACGAGGCCGCCACGAAAGGCTTGCCAGGCAAACTGGTCGGCACAAGCAACGTGCACTTGGCC
ATGCGATTCGGCCTCACTCCCATCGGTACTGTGGCTCATGAATGGTTCATGGGAACAGCTTCCATCATCGACGAC
TACCAAAAGGCAACAGAAGAAGCCCTGCGGCACTGGATAGGCTGTTTTGGCTCCAGTCTAACCATTGCTTTAACG
GACACTTTCGGTACGCCCGAGTTCCTCAAGGCTTTTAGCCTGCCAATCCGCCCGGTCGAAGGCTGTTTTGTTCCG
GATTTCTTTAGGAAATCCGATGGCGCCTATAAAACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGT
GATCCCGCAGAGTACACCAAGACGATGCGGTCATACTACGATGAACAAGGCATCAAAGACAAGAAGAAGATTATC
TTTTCCGATTCTCTCAACATTGAGCGCTGTCTGGAGTATAAGCGCATCTCGGAAGAGTGCGGCTTACAGCCTAGC
TTTGGCGTGGGCACCTTTCTGTCAAACGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTAAACATC
GTCATCAAGCTCAGTTCGGCTGCAGGTCGCCCGGCCATCAAGATCAGCGACACCGTGGGGAAGAACACGGGAGAC
AAGAACGTCGTGGAAAGAGTCAAGCGCGAGCTCGGCTACGTGGAGCGTCACTGGGAGGAGGGCGACGAGAGCACG
AGATGGGGCAAGGAAGAGCCGGCAAGAAGATAG
Transcript >Ophcf2|02386
ATGAACTCGGACAGCTCACCGCCCCCGCTCGTCGGGATCGAATCCATCCTCGACACCGATCTGTACAAGTTGACG
ATGCAATGTGCTGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAATCGCACTCCCGACAAG
AAGTTCTCTCGCGCCGCTTTCGAATGGCTTGACGAGCAGGTACAGAAACTGGCCAACGTTTCTCTCTCCGAAGAC
GAATATACCTTTCTGGAATCAAAATGCAGCTACTTCACCGCCGACTATCTCGAGTATCTGCGAAACTTTCGGCTG
CGGCCGAGCGAGGAGGTTTCGATGACGTTTACACCTATCGGTACCAAATCAGACGTGGGAGATATCGACATTCAA
ATCACAGGATCCTGGTCCGGCACGATTCTCTATGAGATCCCGCTTCTTGCGCTCGTATCAGAGGCCTACTTTCGT
TTCATGGACACGGACTGGAACTATGACGGTCAGGAGGAACAGGCATACGCCAAGGGCATTCAGCTTCTGGAAGCG
GGCTGCCTTACATCCGAGTTTGGCACGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTA
GTGAGGGCATCCAACGAGGCCGCCACGAAAGGCTTGCCAGGCAAACTGGTCGGCACAAGCAACGTGCACTTGGCC
ATGCGATTCGGCCTCACTCCCATCGGTACTGTGGCTCATGAATGGTTCATGGGAACAGCTTCCATCATCGACGAC
TACCAAAAGGCAACAGAAGAAGCCCTGCGGCACTGGATAGGCTGTTTTGGCTCCAGTCTAACCATTGCTTTAACG
GACACTTTCGGTACGCCCGAGTTCCTCAAGGCTTTTAGCCTGCCAATCCGCCCGGTCGAAGGCTGTTTTGTTCCG
GATTTCTTTAGGAAATCCGATGGCGCCTATAAAACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGT
GATCCCGCAGAGTACACCAAGACGATGCGGTCATACTACGATGAACAAGGCATCAAAGACAAGAAGAAGATTATC
TTTTCCGATTCTCTCAACATTGAGCGCTGTCTGGAGTATAAGCGCATCTCGGAAGAGTGCGGCTTACAGCCTAGC
TTTGGCGTGGGCACCTTTCTGTCAAACGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTAAACATC
GTCATCAAGCTCAGTTCGGCTGCAGGTCGCCCGGCCATCAAGATCAGCGACACCGTGGGGAAGAACACGGGAGAC
AAGAACGTCGTGGAAAGAGTCAAGCGCGAGCTCGGCTACGTGGAGCGTCACTGGGAGGAGGGCGACGAGAGCACG
AGATGGGGCAAGGAAGAGCCGGCAAGAAGATAG
Gene >Ophcf2|02386
ATGAACTCGGACAGCTCACCGCCCCCGCTCGTCGGGATCGAATCCATCCTCGACACCGATCTGTACAAGTTGACG
ATGCAATGTGCTGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAATCGCACTCCCGACAAG
AAGTTCTCTCGCGCCGCTTTCGAATGGCTTGACGAGCAGGTACAGAGTAAGTCGACGACGTATGCCTCTTCATGG
CTGCGGCTGACGAATGCTTGTAGAACTGGCCAACGTTTCTCTCTCCGAAGACGAATATACCTTTCTGGAATCAAA
ATGCAGCTACTTCACCGCCGACTATCTCGAGTATCTGCGAAACTTTCGGCTGCGGCCGAGCGAGGAGGTTTCGAT
GACGTTTACACCTATCGGTACCAAATCAGACGTGGGAGATATCGACATTCAAATCACAGGATCCTGGTCCGGCAC
GATTCTCTATGAGATCCCGCTTCTTGCGCTCGTATCAGAGGCCTACTTTCGTTTCATGGACACGGACTGGAACTA
TGACGGTCAGGAGGAACAGGCATACGCCAAGGGCATTCAGCTTCTGGAAGCGGGCTGCCTTACATCCGAGTTTGG
CACGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTAGTGAGGGCATCCAACGAGGCCGC
CACGAAAGGCTTGCCAGGCAAACTGGTCGGCACAAGCAACGTGCACTTGGCCATGCGATTCGGCCTCACTCCCAT
CGGTACTGTGGCTCATGAATGGTTCATGGGAACAGCTTCCATCATCGACGACTACCAAAAGGCAACAGAAGAAGC
CCTGCGGCACTGGATAGGCTGTTTTGGCTCCAGTCTAACCATTGCTTTAACGGACACTTTCGGTACGCCCGAGTT
CCTCAAGGCTTTTAGCCTGCCAATCCGCCCGGTCGAAGGCTGTTTTGTTCCGGATTTCTTTAGGAAATCCGATGG
CGCCTATAAAACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGTGATCCCGCAGAGTACACCAAGAC
GATGCGGTCATACTACGATGAACAAGGCATCAAAGACAAGAAGAAGATTATCTTTTCCGATTCTCTCAACATTGA
GCGCTGTCTGGAGTATAAGCGCATCTCGGAAGAGTGCGGCTTACAGCCTAGCTTTGGCGTGGGCACCTTTCTGTC
AAACGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTAAACATCGTCATCAAGCTCAGTTCGGCTGC
AGGTCGCCCGGCCATCAAGATCAGGTAAGTGCTGATCCAACAGTCCCAATGGACTAGCGATCTGCTGATCAGATA
CAGCGACACCGTGGGGAAGAACACGGGAGACAAGAACGTCGTGGAAAGAGTCAAGCGCGAGCTCGGCTACGTGGA
GCGTCACTGGGAGGAGGGCGACGAGAGCACGAGATGGGGCAAGGAAGAGCCGGCAAGAAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail