Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02384
Gene name
Locationscaffold_02:3510017..3510361
Strand+
Gene length (bp)344
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0975 0.0518 0.9507 0.1433 0.1168 0.0461 0.098 0.1464 0.0244 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7417
Ophiocordyceps australis map64 (Brazil) OphauB2|7158
Ophiocordyceps camponoti-floridani Ophcf2|01050
Ophiocordyceps camponoti-floridani Ophcf2|02384 (this protein)
Ophiocordyceps kimflemingae Ophio5|6908
Ophiocordyceps subramaniannii Hirsu2|185
Ophiocordyceps subramaniannii Hirsu2|5775
Ophiocordyceps subramaniannii Hirsu2|6831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02384
MRAALILLPAIVTSRFCKRGFHYCGSTLLQVGLENQQRMEQAVESQLGKSNRPASLNHCFFYCEYDGRPGQVRLD
AVCPYGCVDAGRGLDDYCHLP*
Coding >Ophcf2|02384
ATGAGAGCCGCGCTCATCCTCCTCCCCGCAATCGTCACCTCCCGCTTCTGCAAACGCGGCTTCCACTACTGCGGC
AGCACCCTCCTCCAAGTCGGCCTCGAGAACCAACAACGGATGGAGCAGGCAGTCGAGTCTCAGCTCGGGAAATCC
AACCGTCCGGCGTCTTTGAACCATTGCTTCTTCTACTGCGAGTACGACGGTCGGCCCGGTCAGGTCCGTCTAGAC
GCCGTGTGTCCGTACGGCTGCGTAGATGCTGGACGCGGGCTCGACGACTATTGCCATCTCCCCTGA
Transcript >Ophcf2|02384
ATGAGAGCCGCGCTCATCCTCCTCCCCGCAATCGTCACCTCCCGCTTCTGCAAACGCGGCTTCCACTACTGCGGC
AGCACCCTCCTCCAAGTCGGCCTCGAGAACCAACAACGGATGGAGCAGGCAGTCGAGTCTCAGCTCGGGAAATCC
AACCGTCCGGCGTCTTTGAACCATTGCTTCTTCTACTGCGAGTACGACGGTCGGCCCGGTCAGGTCCGTCTAGAC
GCCGTGTGTCCGTACGGCTGCGTAGATGCTGGACGCGGGCTCGACGACTATTGCCATCTCCCCTGA
Gene >Ophcf2|02384
ATGAGAGCCGCGCTCATCCTCCTCCCCGCAATCGTCACCTCCCGCTTCTGCAAACGCGGCTTCCACTACTGCGGC
AGCACCCTCCTCCAAGTCGGCCGTACGTCACCAACTCCCCCATCCCTCCCCAATCGCAAACCTCACCCTCAGCAG
TCGAGAACCAACAACGGATGGAGCAGGCAGTCGAGTCTCAGCTCGGGAAATCCAACCGTCCGGCGTCTTTGAACC
ATTGCTTCTTCTACTGCGAGTACGACGGTCGGCCCGGTCAGGTCCGTCTAGACGCCGTGTGTCCGTACGGCTGCG
TAGATGCTGGACGCGGGCTCGACGACTATTGCCATCTCCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail