Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02383
Gene name
Locationscaffold_02:3506594..3507564
Strand-
Gene length (bp)970
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 6.6E-88 42 255

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 91 110 19
3 122 144 22
4 154 176 22
5 181 203 22
6 213 235 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 280.41 155.64 405.17
Alive In ants, during behavior modification 279.61 148.86 410.35
Dead In ants, recently dead 240.87 127.38 354.35

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.991944 no
Alive Dead 0.434976 no
Dead Fungus 0.485840 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02383
MSAENASRAPSLELEKEARSGAGPVHRHHHHDYSHMSAGPSAGALQPGLWKPYEHRKLANPAPLGLSAFALTTFV
LSAINMHARGVSQPNIVVSIAFGYGGLVQLLAGMWEFACGNTFGATAFSSYGGFWISYGIILTPSWGILSQEGPY
HGNVASPVGFFLTGWFIFTTLMLLCTLRSTVSFFLLFFFLDLAFLFLATEQYALDVGHKGLGLVLQKTGGAFGFA
AAFLAWYNALSGLQDSSNSFFQVPVLHFPWSDHVRERRKSDRSQA*
Coding >Ophcf2|02383
ATGTCAGCCGAAAACGCCAGCCGCGCTCCATCGCTAGAACTGGAAAAAGAAGCCCGCTCCGGCGCCGGCCCCGTC
CACCGCCATCACCATCACGATTACTCCCACATGTCGGCCGGTCCCAGCGCCGGCGCCCTCCAGCCGGGCCTATGG
AAGCCCTACGAGCATCGCAAGCTGGCCAATCCCGCGCCTCTCGGTCTCAGCGCCTTCGCCCTCACCACCTTCGTC
CTGTCCGCTATCAATATGCATGCCCGCGGCGTGTCTCAGCCAAACATCGTCGTCTCAATCGCCTTCGGCTACGGC
GGCCTCGTTCAGCTTCTCGCCGGCATGTGGGAGTTTGCCTGCGGTAACACATTCGGTGCCACCGCCTTCTCGTCA
TATGGCGGCTTCTGGATCTCGTACGGCATCATCCTCACCCCCTCCTGGGGCATCCTCTCCCAAGAGGGCCCCTAC
CACGGCAACGTCGCCAGCCCCGTCGGCTTCTTTCTCACCGGCTGGTTCATCTTCACCACCCTCATGCTGCTCTGC
ACCCTTCGTTCCACCGTCAGCTTCTTCCTCCTCTTCTTCTTCCTCGATCTGGCCTTCCTCTTCCTCGCCACCGAG
CAGTACGCCCTCGACGTCGGCCACAAGGGTCTCGGCCTCGTGCTGCAGAAGACGGGCGGCGCCTTCGGTTTCGCA
GCCGCTTTCCTGGCCTGGTATAACGCGCTGTCCGGACTCCAGGACAGCAGCAACTCGTTCTTCCAGGTGCCCGTC
CTGCACTTCCCCTGGTCCGATCACGTCCGCGAGCGCCGCAAAAGTGATCGCTCTCAGGCCTGA
Transcript >Ophcf2|02383
ATGTCAGCCGAAAACGCCAGCCGCGCTCCATCGCTAGAACTGGAAAAAGAAGCCCGCTCCGGCGCCGGCCCCGTC
CACCGCCATCACCATCACGATTACTCCCACATGTCGGCCGGTCCCAGCGCCGGCGCCCTCCAGCCGGGCCTATGG
AAGCCCTACGAGCATCGCAAGCTGGCCAATCCCGCGCCTCTCGGTCTCAGCGCCTTCGCCCTCACCACCTTCGTC
CTGTCCGCTATCAATATGCATGCCCGCGGCGTGTCTCAGCCAAACATCGTCGTCTCAATCGCCTTCGGCTACGGC
GGCCTCGTTCAGCTTCTCGCCGGCATGTGGGAGTTTGCCTGCGGTAACACATTCGGTGCCACCGCCTTCTCGTCA
TATGGCGGCTTCTGGATCTCGTACGGCATCATCCTCACCCCCTCCTGGGGCATCCTCTCCCAAGAGGGCCCCTAC
CACGGCAACGTCGCCAGCCCCGTCGGCTTCTTTCTCACCGGCTGGTTCATCTTCACCACCCTCATGCTGCTCTGC
ACCCTTCGTTCCACCGTCAGCTTCTTCCTCCTCTTCTTCTTCCTCGATCTGGCCTTCCTCTTCCTCGCCACCGAG
CAGTACGCCCTCGACGTCGGCCACAAGGGTCTCGGCCTCGTGCTGCAGAAGACGGGCGGCGCCTTCGGTTTCGCA
GCCGCTTTCCTGGCCTGGTATAACGCGCTGTCCGGACTCCAGGACAGCAGCAACTCGTTCTTCCAGGTGCCCGTC
CTGCACTTCCCCTGGTCCGATCACGTCCGCGAGCGCCGCAAAAGTGATCGCTCTCAGGCCTGA
Gene >Ophcf2|02383
ATGTCAGCCGAAAACGCCAGCCGCGCTCCATCGCTAGAACTGGAAAAAGAAGCCCGCTCCGGCGCCGGCCCCGTC
CACCGCCATCACCATCACGATTACTCCCACATGTCGGCCGGTCCCAGCGCCGGCGCCCTCCAGCCGGGCCTATGG
AAGCCCTACGAGCATCGCAAGCTGGCCAATCCCGCGCCTCTCGGTCTCAGCGCCTTCGCCCTCACCACCTTCGTC
CTGTCCGCTATCAATATGCATGCCCGCGGCGTGTCTCAGCCAAACATCGTCGTCTCAATCGCCTTCGGCTACGGC
GGCCTCGTTCAGCTTCTCGCCGGCATGTGGTGAGTCGCCCTAGTTTATCGTCTTGTCTCTCTCTCTCACCTTAGT
GTTTCCTCTTTTATCCTCTCATATATCTATACGTACTCAGATTCTGACCCCATTGACCAGGGAGTTTGCCTGCGG
TAACACATTCGGTGCCACCGCCTTCTCGTCATATGGCGGCTTCTGGATCTCGTACGGCATCATCCTCACCCCCTC
CTGGGGCATCCTCTCCCAAGAGGGCCCCTACCACGGCAACGTCGCCAGCCCCGTCGGCTTCTTTCTCACCGGCTG
GTTCATCTTCACCACCCTCATGCTGCTCTGCACCCTTCGTTCCACCGTCAGCTTCTTCCTCCTCTTCTTCTTCCT
CGATCTGGCCTTCCTCTTCCTCGCCACCGAGCAGTACGCCCTCGACGTCGGCCACAAGGGTCTCGGCCTCGTGCT
GCAGAAGACGGGCGGCGCCTTCGGTTTCGCAGCCGCTTTCCTGGCCTGGTATAACGCGCTGTCCGGACTCCAGGA
CAGCAGGTCAGTTGGCCCTGAACTCGGACCTTGTTCAGCAGACTGACTCTTCCGCAGCAACTCGTTCTTCCAGGT
GCCCGTCCTGCACTTCCCCTGGTCCGATCACGTCCGCGAGCGCCGCAAAAGTGATCGCTCTCAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail