Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02370
Gene name
Locationscaffold_02:3477916..3478624
Strand-
Gene length (bp)708
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01988 VIT1 VIT family 4.3E-53 9 213

GO

GO Term Description Terminal node
GO:0030026 cellular manganese ion homeostasis Yes
GO:0005384 manganese ion transmembrane transporter activity Yes
GO:0006873 cellular ion homeostasis No
GO:0055082 cellular chemical homeostasis No
GO:0065008 regulation of biological quality No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0006875 cellular metal ion homeostasis No
GO:0046916 cellular transition metal ion homeostasis No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0055076 transition metal ion homeostasis No
GO:0019725 cellular homeostasis No
GO:0008324 cation transmembrane transporter activity No
GO:0030003 cellular cation homeostasis No
GO:0003674 molecular_function No
GO:0098771 inorganic ion homeostasis No
GO:0048878 chemical homeostasis No
GO:0055071 manganese ion homeostasis No
GO:0042592 homeostatic process No
GO:0015075 ion transmembrane transporter activity No
GO:0055065 metal ion homeostasis No
GO:0065007 biological regulation No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0055080 cation homeostasis No
GO:0050801 ion homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22
3 130 152 22
4 156 178 22
5 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02370
MDLADTLHHVIIGFSDGLTVPFALTAGLSSLGSTRLVVIGGLAELFSGMISMGLGAYLAAVTERDRSRQERQLAG
QVDLYALLRDCYAISPSVARALVNDLGQDHDVRCQRLRDDLIHQRDHDPSRIRPCLAGFTMGASYFIGGLIPMIP
YFFVARVRDALCISVIVTVAVLLVFGYVKDYLAIRNHRAGCWGAFLTLVIGVVAAGTSYAIVRALDAAGDSLSIL
DSSRSVLSVK*
Coding >Ophcf2|02370
ATGGACCTAGCCGACACGCTCCACCACGTCATCATCGGCTTCTCAGACGGTCTGACCGTTCCCTTTGCCCTCACC
GCCGGCCTCTCCTCCCTCGGCAGCACCCGACTGGTCGTCATCGGCGGTCTGGCCGAGCTCTTCTCCGGCATGATT
AGCATGGGGCTGGGCGCTTACCTCGCCGCCGTGACGGAGAGAGACCGCTCGAGACAGGAGCGCCAGCTTGCCGGT
CAGGTCGATCTATACGCCCTGCTACGCGACTGCTATGCCATCTCGCCCTCCGTGGCGAGGGCCCTGGTCAATGAC
CTCGGTCAGGACCACGACGTCCGCTGTCAACGTCTCCGCGATGATCTCATTCACCAGCGGGATCACGATCCTTCT
CGCATCCGTCCGTGTCTCGCTGGCTTCACCATGGGCGCCAGCTACTTCATCGGAGGCCTCATCCCCATGATCCCC
TACTTCTTCGTCGCCCGCGTCCGCGACGCTCTCTGCATCTCCGTCATCGTCACCGTCGCCGTCCTCCTCGTCTTT
GGCTACGTCAAGGATTATCTGGCCATTCGCAATCACCGCGCCGGCTGCTGGGGCGCCTTCCTTACTCTCGTTATA
GGCGTCGTCGCCGCCGGCACGAGCTACGCCATCGTCCGAGCCTTGGATGCCGCTGGCGATTCTCTCTCCATCTTA
GATTCTTCTAGATCTGTTCTATCTGTCAAATAG
Transcript >Ophcf2|02370
ATGGACCTAGCCGACACGCTCCACCACGTCATCATCGGCTTCTCAGACGGTCTGACCGTTCCCTTTGCCCTCACC
GCCGGCCTCTCCTCCCTCGGCAGCACCCGACTGGTCGTCATCGGCGGTCTGGCCGAGCTCTTCTCCGGCATGATT
AGCATGGGGCTGGGCGCTTACCTCGCCGCCGTGACGGAGAGAGACCGCTCGAGACAGGAGCGCCAGCTTGCCGGT
CAGGTCGATCTATACGCCCTGCTACGCGACTGCTATGCCATCTCGCCCTCCGTGGCGAGGGCCCTGGTCAATGAC
CTCGGTCAGGACCACGACGTCCGCTGTCAACGTCTCCGCGATGATCTCATTCACCAGCGGGATCACGATCCTTCT
CGCATCCGTCCGTGTCTCGCTGGCTTCACCATGGGCGCCAGCTACTTCATCGGAGGCCTCATCCCCATGATCCCC
TACTTCTTCGTCGCCCGCGTCCGCGACGCTCTCTGCATCTCCGTCATCGTCACCGTCGCCGTCCTCCTCGTCTTT
GGCTACGTCAAGGATTATCTGGCCATTCGCAATCACCGCGCCGGCTGCTGGGGCGCCTTCCTTACTCTCGTTATA
GGCGTCGTCGCCGCCGGCACGAGCTACGCCATCGTCCGAGCCTTGGATGCCGCTGGCGATTCTCTCTCCATCTTA
GATTCTTCTAGATCTGTTCTATCTGTCAAATAG
Gene >Ophcf2|02370
ATGGACCTAGCCGACACGCTCCACCACGTCATCATCGGCTTCTCAGACGGTCTGACCGTTCCCTTTGCCCTCACC
GCCGGCCTCTCCTCCCTCGGCAGCACCCGACTGGTCGTCATCGGCGGTCTGGCCGAGCTCTTCTCCGGCATGATT
AGCATGGGGCTGGGCGCTTACCTCGCCGCCGTGACGGAGAGAGACCGCTCGAGACAGGAGCGCCAGCTTGCCGGT
CAGGTCGATCTATACGCCCTGCTACGCGACTGCTATGCCATCTCGCCCTCCGTGGCGAGGGCCCTGGTCAATGAC
CTCGGTCAGGACCACGACGTCCGCTGTCAACGTCTCCGCGATGATCTCATTCACCAGCGGGATCACGATCCTTCT
CGCATCCGTCCGTGTCTCGCTGGCTTCACCATGGGCGCCAGCTACTTCATCGGAGGCCTCATCCCCATGATCCCC
TACTTCTTCGTCGCCCGCGTCCGCGACGCTCTCTGCATCTCCGTCATCGTCACCGTCGCCGTCCTCCTCGTCTTT
GGCTACGTCAAGGATTATCTGGCCATTCGCAATCACCGCGCCGGCTGCTGGGGCGCCTTCCTTACTCTCGTTATA
GGCGTCGTCGCCGCCGGCACGAGCTACGCCATCGTCCGAGCCTTGGATGCCGCTGGCGATTCTCTCTCCATCTTA
GATTCTTCTAGATCTGTTCTATCTGTCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail