Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02369
Gene name
Locationscaffold_02:3474867..3477618
Strand+
Gene length (bp)2751
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 1.3E-09 137 172
PF13202 EF-hand_5 EF hand 2.7E-03 282 301

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02369
MWLSTPSVETLTRPRLAVAVVSTVAAVSACYLVFQSSWSTGFRDRTGFTGALRRSNAVRRSRRRDTNGSSSSSDA
GVDENVQADHLAAEVETVVDVGADEWWNDLAGFQPSQRAGHNIVSLLFRVSEDNARRNGCVHRGCQCNACGMVPI
RGVRYRCANCADFDLCETCEAQGIHVRTHIFYKIRVPAPPFGPRQMQPVWYTGDPDTCRRSLPRGLIAKLSRDTG
FERPELEAFWEQWTFMAFSEWREDPDELGVAMDRRTFERCLVPTGGSRHAAPNLIHDRMFAFYDANNDGLISFSE
FLHGLSYRRRRDKLRKVFEGYDIDGDGFVNRRDFLRMFRAYYVLYKQMHKDILDGLEDQLLASTDAAGVVHSRQP
LSSLFGREGRVPPADGGMRFDGKTLHRDGTVVVDDGHRSTTIESRGDTATREDILTSLFAYETLQQPRRRFVAQR
DTDTNWRTVRRLSANDADRAYWVTLLDPPDSLDELPDVLTGAGLRDAEQTEDEADDEDDLNGHRSQHGGDSADGR
RRTADDMDGTDSERRARMLSRARRKAPKMEKRRRDMARSQLHERWRRRQFYLDEEEGGLAPEDWDQDEDVLAKLR
MAADEAQATAAAAAAAAAQTRSRSSSKVRFAQDMDDFDTRSNPSTSSRSMPERWGGMGVPDAERDAGKEILYQVT
QQAFNELLDTIFKPAEDLAVEAAETKEQRERFRAEIDAVDEAMDTDKAKESDPRPAPEKANRDKSAEDAVSEAML
TNAGMFERRNAVDLDYLVNLSDYPIPLESSVSEDEEPADEEHRDPTMPQFRPNGPSEEGEVTGKRKRGKGKKRPG
STEAEAGENRSGSGGSWSGEDGPSSTRSSGSEPSVMTLRRWKQLDEAEAKAAARGGWGRLSFDEFEAIYKNQEDQ
GNRLDYLGSWIDFCIP*
Coding >Ophcf2|02369
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCGTCGTCTCGACCGTCGCT
GCCGTCTCTGCCTGTTATCTCGTCTTCCAGTCCAGCTGGTCGACCGGCTTCCGCGACCGCACCGGCTTCACAGGG
GCCTTGCGTAGGAGCAACGCAGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGTCGACGAGAATGTGCAGGCAGACCATCTGGCAGCTGAAGTCGAGACGGTCGTCGACGTCGGGGCCGATGAG
TGGTGGAACGACCTGGCCGGCTTTCAGCCCTCGCAACGCGCTGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGTCAATGCAACGCGTGCGGCATGGTGCCCATC
CGAGGAGTTCGCTACCGATGCGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATCCAC
GTAAGGACGCACATCTTCTACAAGATCAGAGTTCCCGCGCCGCCCTTTGGCCCCCGCCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGATACCTGCCGTCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCCGAGCTCGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCCATGGACCGGAGGACCTTTGAGCGCTGCCTCGTTCCCACCGGCGGCTCACGTCACGCG
GCTCCCAATCTCATCCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGATGGGCTCATCAGCTTCTCCGAG
TTTCTTCATGGCCTGTCGTACCGGAGGCGTAGGGATAAGCTTCGCAAGGTCTTTGAGGGCTACGACATTGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTTCGCGCCTACTACGTCCTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTTGAGGACCAGCTCCTCGCCAGCACGGACGCCGCCGGTGTCGTCCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCCGACGGCGGCATGCGCTTCGACGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGCCATCGCAGCACCACCATCGAGAGCCGCGGCGACACGGCGACC
CGCGAAGACATCCTGACGAGCCTCTTTGCCTACGAGACGCTGCAGCAGCCTCGCCGCCGCTTCGTGGCACAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTTACCCTC
TTGGATCCTCCCGATTCTCTCGACGAGCTGCCCGATGTCCTTACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGATGACCTCAATGGTCACCGAAGCCAACACGGCGGTGACTCCGCCGACGGCAGA
CGGCGAACGGCAGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGCCGGAAG
GCGCCCAAGATGGAGAAGCGTCGACGAGACATGGCACGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTT
TACCTCGACGAGGAGGAGGGTGGCCTGGCCCCTGAAGACTGGGATCAGGACGAGGACGTACTGGCCAAGCTTAGG
ATGGCGGCCGACGAGGCGCAGGCAACTGCTGCTGCTGCTGCGGCGGCGGCGGCACAGACACGTTCACGGTCGAGC
TCCAAGGTCCGTTTCGCGCAAGATATGGACGACTTCGACACGCGGTCCAACCCGTCGACCTCGTCGAGGAGCATG
CCCGAACGCTGGGGAGGTATGGGCGTACCCGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTACCAGGTGACG
CAACAGGCCTTCAACGAGCTGCTCGACACCATATTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCGAGACG
AAGGAACAGCGCGAGAGATTCCGGGCCGAGATCGACGCCGTCGATGAGGCCATGGACACGGACAAGGCAAAGGAG
TCGGACCCGCGCCCGGCCCCGGAAAAGGCCAACCGGGACAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTG
ACCAATGCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGACTATCTTGTCAACCTCTCCGACTACCCCATA
CCCTTAGAGTCATCCGTGTCGGAAGACGAGGAGCCGGCCGACGAGGAGCACCGCGACCCGACGATGCCCCAGTTC
CGGCCCAACGGCCCCTCAGAGGAGGGCGAGGTGACGGGCAAGAGGAAGAGGGGGAAGGGCAAGAAGCGGCCGGGC
TCTACGGAAGCCGAGGCAGGCGAGAACAGGTCCGGATCCGGCGGTTCATGGTCGGGCGAGGACGGGCCGTCGTCG
ACGCGCTCTTCCGGAAGCGAGCCCTCGGTGATGACGCTGAGGCGTTGGAAGCAGCTCGACGAAGCCGAGGCTAAG
GCTGCAGCGAGGGGCGGCTGGGGCAGGCTTAGCTTTGATGAGTTCGAGGCCATCTACAAGAACCAGGAAGACCAG
GGCAATAGGCTCGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG
Transcript >Ophcf2|02369
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCGTCGTCTCGACCGTCGCT
GCCGTCTCTGCCTGTTATCTCGTCTTCCAGTCCAGCTGGTCGACCGGCTTCCGCGACCGCACCGGCTTCACAGGG
GCCTTGCGTAGGAGCAACGCAGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGTCGACGAGAATGTGCAGGCAGACCATCTGGCAGCTGAAGTCGAGACGGTCGTCGACGTCGGGGCCGATGAG
TGGTGGAACGACCTGGCCGGCTTTCAGCCCTCGCAACGCGCTGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGTCAATGCAACGCGTGCGGCATGGTGCCCATC
CGAGGAGTTCGCTACCGATGCGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATCCAC
GTAAGGACGCACATCTTCTACAAGATCAGAGTTCCCGCGCCGCCCTTTGGCCCCCGCCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGATACCTGCCGTCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCCGAGCTCGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCCATGGACCGGAGGACCTTTGAGCGCTGCCTCGTTCCCACCGGCGGCTCACGTCACGCG
GCTCCCAATCTCATCCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGATGGGCTCATCAGCTTCTCCGAG
TTTCTTCATGGCCTGTCGTACCGGAGGCGTAGGGATAAGCTTCGCAAGGTCTTTGAGGGCTACGACATTGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTTCGCGCCTACTACGTCCTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTTGAGGACCAGCTCCTCGCCAGCACGGACGCCGCCGGTGTCGTCCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCCGACGGCGGCATGCGCTTCGACGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGCCATCGCAGCACCACCATCGAGAGCCGCGGCGACACGGCGACC
CGCGAAGACATCCTGACGAGCCTCTTTGCCTACGAGACGCTGCAGCAGCCTCGCCGCCGCTTCGTGGCACAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTTACCCTC
TTGGATCCTCCCGATTCTCTCGACGAGCTGCCCGATGTCCTTACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGATGACCTCAATGGTCACCGAAGCCAACACGGCGGTGACTCCGCCGACGGCAGA
CGGCGAACGGCAGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGCCGGAAG
GCGCCCAAGATGGAGAAGCGTCGACGAGACATGGCACGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTT
TACCTCGACGAGGAGGAGGGTGGCCTGGCCCCTGAAGACTGGGATCAGGACGAGGACGTACTGGCCAAGCTTAGG
ATGGCGGCCGACGAGGCGCAGGCAACTGCTGCTGCTGCTGCGGCGGCGGCGGCACAGACACGTTCACGGTCGAGC
TCCAAGGTCCGTTTCGCGCAAGATATGGACGACTTCGACACGCGGTCCAACCCGTCGACCTCGTCGAGGAGCATG
CCCGAACGCTGGGGAGGTATGGGCGTACCCGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTACCAGGTGACG
CAACAGGCCTTCAACGAGCTGCTCGACACCATATTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCGAGACG
AAGGAACAGCGCGAGAGATTCCGGGCCGAGATCGACGCCGTCGATGAGGCCATGGACACGGACAAGGCAAAGGAG
TCGGACCCGCGCCCGGCCCCGGAAAAGGCCAACCGGGACAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTG
ACCAATGCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGACTATCTTGTCAACCTCTCCGACTACCCCATA
CCCTTAGAGTCATCCGTGTCGGAAGACGAGGAGCCGGCCGACGAGGAGCACCGCGACCCGACGATGCCCCAGTTC
CGGCCCAACGGCCCCTCAGAGGAGGGCGAGGTGACGGGCAAGAGGAAGAGGGGGAAGGGCAAGAAGCGGCCGGGC
TCTACGGAAGCCGAGGCAGGCGAGAACAGGTCCGGATCCGGCGGTTCATGGTCGGGCGAGGACGGGCCGTCGTCG
ACGCGCTCTTCCGGAAGCGAGCCCTCGGTGATGACGCTGAGGCGTTGGAAGCAGCTCGACGAAGCCGAGGCTAAG
GCTGCAGCGAGGGGCGGCTGGGGCAGGCTTAGCTTTGATGAGTTCGAGGCCATCTACAAGAACCAGGAAGACCAG
GGCAATAGGCTCGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG
Gene >Ophcf2|02369
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCGTCGTCTCGACCGTCGCT
GCCGTCTCTGCCTGTTATCTCGTCTTCCAGTCCAGCTGGTCGACCGGCTTCCGCGACCGCACCGGCTTCACAGGG
GCCTTGCGTAGGAGCAACGCAGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGTCGACGAGAATGTGCAGGCAGACCATCTGGCAGCTGAAGTCGAGACGGTCGTCGACGTCGGGGCCGATGAG
TGGTGGAACGACCTGGCCGGCTTTCAGCCCTCGCAACGCGCTGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGTCAATGCAACGCGTGCGGCATGGTGCCCATC
CGAGGAGTTCGCTACCGATGCGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATCCAC
GTAAGGACGCACATCTTCTACAAGATCAGAGTTCCCGCGCCGCCCTTTGGCCCCCGCCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGATACCTGCCGTCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCCGAGCTCGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCCATGGACCGGAGGACCTTTGAGCGCTGCCTCGTTCCCACCGGCGGCTCACGTCACGCG
GCTCCCAATCTCATCCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGATGGGCTCATCAGCTTCTCCGAG
TTTCTTCATGGCCTGTCGTACCGGAGGCGTAGGGATAAGCTTCGCAAGGTCTTTGAGGGCTACGACATTGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTTCGCGCCTACTACGTCCTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTTGAGGACCAGCTCCTCGCCAGCACGGACGCCGCCGGTGTCGTCCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCCGACGGCGGCATGCGCTTCGACGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGCCATCGCAGCACCACCATCGAGAGCCGCGGCGACACGGCGACC
CGCGAAGACATCCTGACGAGCCTCTTTGCCTACGAGACGCTGCAGCAGCCTCGCCGCCGCTTCGTGGCACAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTTACCCTC
TTGGATCCTCCCGATTCTCTCGACGAGCTGCCCGATGTCCTTACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGATGACCTCAATGGTCACCGAAGCCAACACGGCGGTGACTCCGCCGACGGCAGA
CGGCGAACGGCAGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGCCGGAAG
GCGCCCAAGATGGAGAAGCGTCGACGAGACATGGCACGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTT
TACCTCGACGAGGAGGAGGGTGGCCTGGCCCCTGAAGACTGGGATCAGGACGAGGACGTACTGGCCAAGCTTAGG
ATGGCGGCCGACGAGGCGCAGGCAACTGCTGCTGCTGCTGCGGCGGCGGCGGCACAGACACGTTCACGGTCGAGC
TCCAAGGTCCGTTTCGCGCAAGATATGGACGACTTCGACACGCGGTCCAACCCGTCGACCTCGTCGAGGAGCATG
CCCGAACGCTGGGGAGGTATGGGCGTACCCGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTACCAGGTGACG
CAACAGGCCTTCAACGAGCTGCTCGACACCATATTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCGAGACG
AAGGAACAGCGCGAGAGATTCCGGGCCGAGATCGACGCCGTCGATGAGGCCATGGACACGGACAAGGCAAAGGAG
TCGGACCCGCGCCCGGCCCCGGAAAAGGCCAACCGGGACAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTG
ACCAATGCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGACTATCTTGTCAACCTCTCCGACTACCCCATA
CCCTTAGAGTCATCCGTGTCGGAAGACGAGGAGCCGGCCGACGAGGAGCACCGCGACCCGACGATGCCCCAGTTC
CGGCCCAACGGCCCCTCAGAGGAGGGCGAGGTGACGGGCAAGAGGAAGAGGGGGAAGGGCAAGAAGCGGCCGGGC
TCTACGGAAGCCGAGGCAGGCGAGAACAGGTCCGGATCCGGCGGTTCATGGTCGGGCGAGGACGGGCCGTCGTCG
ACGCGCTCTTCCGGAAGCGAGCCCTCGGTGATGACGCTGAGGCGTTGGAAGCAGCTCGACGAAGCCGAGGCTAAG
GCTGCAGCGAGGGGCGGCTGGGGCAGGCTTAGCTTTGATGAGTTCGAGGCCATCTACAAGAACCAGGAAGACCAG
GGCAATAGGCTCGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail