Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02367
Gene name
Locationscaffold_02:3471434..3473336
Strand+
Gene length (bp)1902
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07534 TLD TLD 1.7E-25 357 552
PF08593 DUF1773 Domain of unknown function 4.1E-09 297 347

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6707 0.5104 0.036 0.1343 0.1994 0.0302 0.1363 0.3622 0.4929 0.032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 45.95 26.21 65.69
Alive In ants, during behavior modification 35.68 19.78 51.58
Dead In ants, recently dead 21.76 11.24 32.29

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.194723 no
Alive Dead 0.004221 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup2620
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2971
Ophiocordyceps australis map64 (Brazil) OphauB2|6328
Ophiocordyceps camponoti-floridani Ophcf2|02367 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|689
Ophiocordyceps kimflemingae Ophio5|4158
Ophiocordyceps subramaniannii Hirsu2|400

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02367
MGQTLSDEQQPHRRSRDELTFELAQRFRDQCFSSLEFYSLKDVFNTLADRQGHVRYLREDTVGRYLEMPDILGAS
PVVFQMLSYLGAFPFLQDAPAVLELAPLVMVVVILTDRYRRVLAKGAADRTKLLFKSLAVHDRQAWVASGSPPPN
STMATGTRGFAVDAPGEDDGDGEDGKDEGEDDDLVLTAYELLHVTQTSSQVSSRDFHCAIIPTDNFRKLLMLLLL
SAPLQARESLSQYSSRVSGEHLEILRSTAENMLASFVDAETSAGIRYKSFKTIMPVLFPHLFRGFNGLFERFLFS
KHLDLSRRKGESRGSKDKVTEAAQPLLSDHAEILNDHVLSQLSMFIPASSLFRRVRLLYSGNEAGFSMGSFESKV
FNWRAPTVLLVSGTRLDDVPDGGQEAAFADSLPTNRFPAGSKSGRVTYGVYVQESWRHTHKACFGGPDTVLFQLE
PIHDVFPASTLNTEYIAFTKTPGSRNCLSIGCPHPKQTQSHNRRDGAFALGAVSLLLNDSFEFGVFNHDYKSRGG
AFHTSLVRRCDFQDRFQIDRLEVWGCGGDDEAKAQAERWAWEAREAESRRRINLGSGDMAADRALLEMAGIVGGH
RSGGSMA*
Coding >Ophcf2|02367
ATGGGCCAGACGCTGTCAGACGAACAGCAGCCGCACCGCCGCTCCCGTGACGAGCTGACGTTTGAGCTCGCTCAA
CGCTTCAGGGATCAATGTTTCAGCTCGCTCGAGTTCTACTCGCTCAAGGATGTCTTCAACACCCTCGCCGACCGT
CAAGGCCATGTCCGCTATCTTAGGGAAGATACCGTCGGCCGCTACCTCGAGATGCCGGACATTCTCGGGGCTTCG
CCCGTCGTCTTCCAGATGCTTTCGTATCTCGGCGCTTTTCCCTTTTTGCAGGATGCTCCGGCCGTTTTGGAACTC
GCGCCACTCGTCATGGTGGTCGTCATCTTGACGGACCGCTACCGACGCGTTTTGGCCAAGGGGGCCGCAGACAGG
ACCAAGCTTCTCTTCAAGAGCTTGGCTGTGCACGATCGGCAGGCTTGGGTGGCATCTGGCTCGCCGCCGCCTAAC
TCGACGATGGCGACTGGTACTCGGGGATTCGCTGTGGACGCACCCGGGGAAGACGACGGCGACGGCGAGGACGGC
AAGGATGAGGGCGAGGACGATGACTTGGTTCTTACGGCATATGAGCTCCTTCACGTCACCCAGACGTCCAGTCAG
GTCAGCTCTCGCGACTTTCATTGCGCCATCATCCCCACCGACAACTTCCGCAAGCTCCTGATGCTACTGCTCCTG
TCTGCGCCCCTACAGGCCCGAGAAAGTCTATCTCAATACTCGAGCCGAGTATCTGGTGAACATCTTGAGATCTTG
CGGTCGACGGCCGAGAACATGCTCGCCTCATTCGTCGACGCCGAGACTTCCGCCGGCATCAGGTACAAGTCGTTC
AAGACAATCATGCCCGTTCTGTTCCCTCATCTTTTCCGCGGTTTCAATGGTCTCTTCGAGAGATTTCTCTTCTCA
AAGCATTTGGATCTTTCTCGGCGAAAGGGCGAATCCAGAGGTTCAAAGGACAAGGTGACAGAAGCAGCGCAGCCT
CTACTGTCTGATCACGCCGAGATTCTCAACGACCATGTGCTGTCACAACTCTCCATGTTCATTCCGGCGTCCTCC
CTGTTTCGCAGGGTTCGACTGCTCTACTCTGGAAACGAGGCGGGCTTCTCCATGGGCAGCTTCGAATCCAAAGTC
TTCAACTGGAGGGCACCCACGGTACTTCTCGTCAGCGGGACCCGTCTCGATGACGTCCCGGACGGTGGTCAGGAG
GCGGCGTTTGCCGATTCGTTGCCGACCAACAGGTTTCCGGCCGGCAGCAAGTCTGGCCGGGTTACTTATGGCGTC
TATGTGCAAGAGTCCTGGAGGCACACTCACAAGGCCTGCTTCGGAGGTCCGGATACGGTGCTCTTTCAGCTCGAG
CCTATCCACGACGTGTTCCCTGCGTCGACTCTCAACACCGAATACATCGCTTTCACCAAGACCCCCGGCAGCCGC
AACTGTCTGTCCATCGGCTGTCCACACCCAAAGCAGACGCAGTCGCACAATCGTCGAGATGGTGCTTTCGCCCTC
GGTGCTGTGTCGCTGCTCCTCAACGACTCGTTCGAGTTTGGCGTCTTCAACCACGATTACAAGTCCCGAGGCGGT
GCTTTCCACACGAGCCTTGTAAGAAGATGTGACTTTCAAGATCGTTTCCAGATCGACAGGCTCGAGGTCTGGGGG
TGTGGTGGAGATGACGAGGCCAAGGCCCAGGCCGAGCGCTGGGCTTGGGAGGCGAGGGAAGCTGAGTCTCGGAGG
AGGATCAATCTCGGCAGCGGGGACATGGCGGCAGACAGGGCACTGCTGGAGATGGCTGGAATCGTCGGTGGCCAT
CGCAGCGGGGGATCAATGGCGTAG
Transcript >Ophcf2|02367
ATGGGCCAGACGCTGTCAGACGAACAGCAGCCGCACCGCCGCTCCCGTGACGAGCTGACGTTTGAGCTCGCTCAA
CGCTTCAGGGATCAATGTTTCAGCTCGCTCGAGTTCTACTCGCTCAAGGATGTCTTCAACACCCTCGCCGACCGT
CAAGGCCATGTCCGCTATCTTAGGGAAGATACCGTCGGCCGCTACCTCGAGATGCCGGACATTCTCGGGGCTTCG
CCCGTCGTCTTCCAGATGCTTTCGTATCTCGGCGCTTTTCCCTTTTTGCAGGATGCTCCGGCCGTTTTGGAACTC
GCGCCACTCGTCATGGTGGTCGTCATCTTGACGGACCGCTACCGACGCGTTTTGGCCAAGGGGGCCGCAGACAGG
ACCAAGCTTCTCTTCAAGAGCTTGGCTGTGCACGATCGGCAGGCTTGGGTGGCATCTGGCTCGCCGCCGCCTAAC
TCGACGATGGCGACTGGTACTCGGGGATTCGCTGTGGACGCACCCGGGGAAGACGACGGCGACGGCGAGGACGGC
AAGGATGAGGGCGAGGACGATGACTTGGTTCTTACGGCATATGAGCTCCTTCACGTCACCCAGACGTCCAGTCAG
GTCAGCTCTCGCGACTTTCATTGCGCCATCATCCCCACCGACAACTTCCGCAAGCTCCTGATGCTACTGCTCCTG
TCTGCGCCCCTACAGGCCCGAGAAAGTCTATCTCAATACTCGAGCCGAGTATCTGGTGAACATCTTGAGATCTTG
CGGTCGACGGCCGAGAACATGCTCGCCTCATTCGTCGACGCCGAGACTTCCGCCGGCATCAGGTACAAGTCGTTC
AAGACAATCATGCCCGTTCTGTTCCCTCATCTTTTCCGCGGTTTCAATGGTCTCTTCGAGAGATTTCTCTTCTCA
AAGCATTTGGATCTTTCTCGGCGAAAGGGCGAATCCAGAGGTTCAAAGGACAAGGTGACAGAAGCAGCGCAGCCT
CTACTGTCTGATCACGCCGAGATTCTCAACGACCATGTGCTGTCACAACTCTCCATGTTCATTCCGGCGTCCTCC
CTGTTTCGCAGGGTTCGACTGCTCTACTCTGGAAACGAGGCGGGCTTCTCCATGGGCAGCTTCGAATCCAAAGTC
TTCAACTGGAGGGCACCCACGGTACTTCTCGTCAGCGGGACCCGTCTCGATGACGTCCCGGACGGTGGTCAGGAG
GCGGCGTTTGCCGATTCGTTGCCGACCAACAGGTTTCCGGCCGGCAGCAAGTCTGGCCGGGTTACTTATGGCGTC
TATGTGCAAGAGTCCTGGAGGCACACTCACAAGGCCTGCTTCGGAGGTCCGGATACGGTGCTCTTTCAGCTCGAG
CCTATCCACGACGTGTTCCCTGCGTCGACTCTCAACACCGAATACATCGCTTTCACCAAGACCCCCGGCAGCCGC
AACTGTCTGTCCATCGGCTGTCCACACCCAAAGCAGACGCAGTCGCACAATCGTCGAGATGGTGCTTTCGCCCTC
GGTGCTGTGTCGCTGCTCCTCAACGACTCGTTCGAGTTTGGCGTCTTCAACCACGATTACAAGTCCCGAGGCGGT
GCTTTCCACACGAGCCTTGTAAGAAGATGTGACTTTCAAGATCGTTTCCAGATCGACAGGCTCGAGGTCTGGGGG
TGTGGTGGAGATGACGAGGCCAAGGCCCAGGCCGAGCGCTGGGCTTGGGAGGCGAGGGAAGCTGAGTCTCGGAGG
AGGATCAATCTCGGCAGCGGGGACATGGCGGCAGACAGGGCACTGCTGGAGATGGCTGGAATCGTCGGTGGCCAT
CGCAGCGGGGGATCAATGGCGTAG
Gene >Ophcf2|02367
ATGGGCCAGACGCTGTCAGACGAACAGCAGCCGCACCGCCGCTCCCGTGACGAGCTGACGTTTGAGCTCGTGAGC
TTGATCCTCTCGTCTTTGATGGCGGCTCGCTGACACTGTCGGCGACGGCTCGCCCGAGACTCGACTCTCCAGGCT
CAACGCTTCAGGGATCAATGTTTCAGCTCGCTCGAGTTCTACTCGCTCAAGGATGTCTTCAACACCCTCGCCGAC
CGTCAAGGCCATGTCCGCTATCTTAGGGAAGATACCGTCGGCCGCTACCTCGAGATGCCGGACATTCTCGGGGCT
TCGCCCGTCGTCTTCCAGATGCTTTCGTATCTCGGCGCTTTTCCCTTTTTGCAGGATGCTCCGGCCGTTTTGGAA
CTCGCGCCACTCGTCATGGTGGTCGTCATCTTGACGGACCGCTACCGACGCGTTTTGGCCAAGGGGGCCGCAGAC
AGGACCAAGCTTCTCTTCAAGAGCTTGGCTGTGCACGATCGGCAGGCTTGGGTGGCATCTGGCTCGCCGCCGCCT
AACTCGACGATGGCGACTGGTACTCGGGGATTCGCTGTGGACGCACCCGGGGAAGACGACGGCGACGGCGAGGAC
GGCAAGGATGAGGGCGAGGACGATGACTTGGTTCTTACGGCATATGAGCTCCTTCACGTCACCCAGACGTCCAGT
CAGGTCAGCTCTCGCGACTTTCATTGCGCCATCATCCCCACCGACAACTTCCGCAAGCTCCTGATGCTACTGCTC
CTGTCTGCGCCCCTACAGGCCCGAGAAAGTCTATCTCAATACTCGAGCCGAGTATCTGGTGAACATCTTGAGATC
TTGCGGTCGACGGCCGAGAACATGCTCGCCTCATTCGTCGACGCCGAGACTTCCGCCGGCATCAGGTACAAGTCG
TTCAAGACAATCATGCCCGTTCTGTTCCCTCATCTTTTCCGCGGTTTCAATGGTCTCTTCGAGAGATTTCTCTTC
TCAAAGCATTTGGATCTTTCTCGGCGAAAGGGCGAATCCAGAGGTTCAAAGGACAAGGTGACAGAAGCAGCGCAG
CCTCTACTGTCTGATCACGCCGAGATTCTCAACGACCATGTGCTGTCACAACTCTCCATGTTCATTCCGGCGTCC
TCCCTGTTTCGCAGGGTTCGACTGCTCTACTCTGGAAACGAGGCGGGCTTCTCCATGGGCAGCTTCGAATCCAAA
GTCTTCAACTGGAGGGCACCCACGGTACTTCTCGTCAGCGGGACCCGTCTCGATGACGTCCCGGACGGTGGTCAG
GAGGCGGCGTTTGCCGATTCGTTGCCGACCAACAGGTTTCCGGCCGGCAGCAAGTCTGGCCGGGTTACTTATGGC
GTCTATGTGCAAGAGTCCTGGAGGCACACTCACAAGGCCTGCTTCGGAGGTCCGGATACGGTGCTCTTTCAGCTC
GAGCCTATCCACGACGTGTTCCCTGCGTCGACTCTCAACACCGAATACATCGCTTTCACCAAGACCCCCGGCAGC
CGCAACTGTCTGTCCATCGGCTGTCCACACCCAAAGCAGACGCAGTCGCACAATCGTCGAGATGGTGCTTTCGCC
CTCGGTGCTGTGTCGCTGCTCCTCAACGACTCGTTCGAGTTTGGCGTCTTCAACCACGATTACAAGTCCCGAGGC
GGTGCTTTCCACACGAGCCTTGTAAGAAGATGTGACTTTCAAGATCGTTTCCAGATCGACAGGCTCGAGGTCTGG
GGGTGTGGTGGAGATGACGAGGCCAAGGCCCAGGCCGAGCGCTGGGCTTGGGAGGCGAGGGAAGCTGAGTCTCGG
AGGAGGATCAATCTCGGCAGCGGGGACATGGCGGCAGACAGGGCACTGCTGGAGATGGCTGGAATCGTCGGTGGC
CATCGCAGCGGGGGATCAATGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail