Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02363
Gene name
Locationscaffold_02:3462687..3464180
Strand-
Gene length (bp)1493
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.8E-11 123 364
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.3E-10 120 283
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 9.7E-10 121 229

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 34.89 18.24 51.53
Alive In ants, during behavior modification 34.03 17.51 50.54
Dead In ants, recently dead 28.17 14.15 42.20

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.927401 no
Alive Dead 0.353163 no
Dead Fungus 0.351261 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02363
MVKLLRAAALLLVAPYAIYVVVLCLLAIPVVQRHALYAHKINDLFWIDLNGPEAWGFATNQVTPFTIATPDGESV
YAWHITPLPLYLKNEARLTAQPSGLAPNFTETESFRLLREDPEARLILYFHGTAGHIAQAVRPDSYHALTDTSSY
HLVSIDYRGYGLSTGAPTEDGLIQDAAALVDWALRTAAISPDRVVLLGHSLGTAVVSGIAERYARNGVEFAGIVL
VAGFNDLKSLIGEYRIGGVLPLLGPFSLWPKLVRRLERFVVDNWPTSKRLASIVRHTKKRLRISLIHASNDRDIP
CSEDDKLFRAATNETVGIVDDAEFAAWKEQRTVRKRKDAFVTTWTADPDIIVRQELFPYGGHDPIMGFAPVALAI
MRSFDYQGTAYAQTTGDERRPWLSSYSEGS*
Coding >Ophcf2|02363
ATGGTCAAGCTGTTGCGCGCCGCCGCGCTGCTCCTCGTCGCGCCCTACGCCATCTACGTCGTCGTCCTCTGCCTG
CTGGCAATCCCCGTCGTTCAGAGACATGCTCTGTACGCCCACAAGATCAATGACCTCTTCTGGATCGACCTCAAC
GGGCCCGAGGCCTGGGGCTTTGCCACAAACCAGGTGACGCCCTTTACCATTGCGACGCCCGACGGCGAGAGCGTC
TACGCCTGGCATATAACACCCCTACCGCTATATCTCAAGAACGAGGCCCGACTTACCGCTCAACCATCGGGTCTG
GCGCCCAACTTTACCGAAACCGAGTCGTTCCGTCTTCTCCGGGAAGACCCCGAGGCCCGACTGATTCTATACTTC
CACGGAACCGCAGGCCACATCGCGCAGGCCGTACGTCCCGACTCATACCACGCCCTGACGGACACGTCGTCGTAT
CACCTCGTTTCCATCGACTACCGCGGCTACGGCCTTTCCACCGGCGCCCCGACCGAGGACGGCCTGATCCAGGAC
GCGGCGGCGCTCGTCGACTGGGCTTTGCGGACCGCGGCTATCTCACCGGATCGCGTCGTGCTGCTCGGTCATAGC
CTCGGTACGGCCGTCGTCAGTGGCATCGCAGAGCGATACGCGCGCAACGGTGTCGAGTTCGCCGGCATCGTCCTT
GTCGCCGGCTTCAATGACCTCAAGTCTCTCATCGGAGAGTATCGTATCGGCGGGGTGCTGCCGTTGCTGGGCCCC
TTTTCCCTCTGGCCTAAGCTGGTCCGCAGGCTGGAGCGCTTCGTGGTCGATAATTGGCCCACTTCGAAACGACTG
GCCAGCATCGTGAGGCACACGAAGAAGAGGCTTCGCATCAGCCTGATCCATGCCAGCAACGACCGCGATATTCCC
TGCAGCGAGGACGACAAGCTCTTCCGCGCCGCGACCAACGAGACGGTTGGCATCGTCGACGACGCCGAGTTTGCG
GCCTGGAAGGAACAGCGCACGGTTCGTAAGCGCAAGGACGCCTTCGTGACGACCTGGACGGCGGATCCAGACATT
ATCGTCCGCCAAGAGCTGTTTCCGTACGGAGGGCATGACCCCATCATGGGCTTTGCCCCGGTGGCGCTGGCCATC
ATGAGGTCCTTTGACTATCAGGGAACGGCATATGCGCAGACGACGGGTGATGAGAGGAGACCGTGGCTGAGCAGC
TACTCGGAGGGATCGTGA
Transcript >Ophcf2|02363
ATGGTCAAGCTGTTGCGCGCCGCCGCGCTGCTCCTCGTCGCGCCCTACGCCATCTACGTCGTCGTCCTCTGCCTG
CTGGCAATCCCCGTCGTTCAGAGACATGCTCTGTACGCCCACAAGATCAATGACCTCTTCTGGATCGACCTCAAC
GGGCCCGAGGCCTGGGGCTTTGCCACAAACCAGGTGACGCCCTTTACCATTGCGACGCCCGACGGCGAGAGCGTC
TACGCCTGGCATATAACACCCCTACCGCTATATCTCAAGAACGAGGCCCGACTTACCGCTCAACCATCGGGTCTG
GCGCCCAACTTTACCGAAACCGAGTCGTTCCGTCTTCTCCGGGAAGACCCCGAGGCCCGACTGATTCTATACTTC
CACGGAACCGCAGGCCACATCGCGCAGGCCGTACGTCCCGACTCATACCACGCCCTGACGGACACGTCGTCGTAT
CACCTCGTTTCCATCGACTACCGCGGCTACGGCCTTTCCACCGGCGCCCCGACCGAGGACGGCCTGATCCAGGAC
GCGGCGGCGCTCGTCGACTGGGCTTTGCGGACCGCGGCTATCTCACCGGATCGCGTCGTGCTGCTCGGTCATAGC
CTCGGTACGGCCGTCGTCAGTGGCATCGCAGAGCGATACGCGCGCAACGGTGTCGAGTTCGCCGGCATCGTCCTT
GTCGCCGGCTTCAATGACCTCAAGTCTCTCATCGGAGAGTATCGTATCGGCGGGGTGCTGCCGTTGCTGGGCCCC
TTTTCCCTCTGGCCTAAGCTGGTCCGCAGGCTGGAGCGCTTCGTGGTCGATAATTGGCCCACTTCGAAACGACTG
GCCAGCATCGTGAGGCACACGAAGAAGAGGCTTCGCATCAGCCTGATCCATGCCAGCAACGACCGCGATATTCCC
TGCAGCGAGGACGACAAGCTCTTCCGCGCCGCGACCAACGAGACGGTTGGCATCGTCGACGACGCCGAGTTTGCG
GCCTGGAAGGAACAGCGCACGGTTCGTAAGCGCAAGGACGCCTTCGTGACGACCTGGACGGCGGATCCAGACATT
ATCGTCCGCCAAGAGCTGTTTCCGTACGGAGGGCATGACCCCATCATGGGCTTTGCCCCGGTGGCGCTGGCCATC
ATGAGGTCCTTTGACTATCAGGGAACGGCATATGCGCAGACGACGGGTGATGAGAGGAGACCGTGGCTGAGCAGC
TACTCGGAGGGATCGTGA
Gene >Ophcf2|02363
ATGGTCAAGCTGTTGCGCGCCGCCGCGCTGCTCCTCGTCGCGCCCTACGCCATCTACGTCGTCGTCCTCTGCCTG
CTGGCAATCCCCGTCGTTCAGAGACAGTCGGTGGCCCGTCCCGTCGCTTCCGAACCATACGCAGCTGACGTCGGC
CGCCTCACAGTGCTCTGTACGCCCACAAGATCAATGACCTCTTCTGGATCGACCTCAACGGGCCCGAGGCCTGGG
GCTTTGCCAGTATGTCGCTAGGAGCTGGCTATGTCTGTGTTCTGACGCCGTTCTCGCAGCAAACCAGGTGACGCC
CTTTACCATTGCGACGCCCGACGGCGAGAGCGTCTACGCCTGGCATATAACACCCCTACCGCTATATCTCAAGAA
CGAGGCCCGACTTACCGCTCAACCATCGGGTCTGGCGCCCAACTTTACCGAAACCGAGTCGTTCCGTCTTCTCCG
GGAAGACCCCGAGGCCCGACTGATTCTATACTGTAGGCTGCCTCGCTTCTCAGAGTCTTACGCGTCCAGCAGAGC
TAATCCTTTGTGCGTCAGTCCACGGAGTACGTCGGACGAGTACCGTCGCGGCCAAATAAAGAGCTCACGTTCCAT
TACAGACCGCAGGCCACATCGCGCAGGCCGTACGTCCCGACTCATACCACGCCCTGACGGACACGTCGTCGTATC
ACCTCGTTTCCATCGACTACCGCGGCTACGGCCTTTCCACCGGCGCCCCGACCGAGGACGGCCTGATCCAGGACG
CGGCGGCGCTCGTCGACTGGGCTTTGCGGACCGCGGCTATCTCACCGGATCGCGTCGTGCTGCTCGGTCATAGCC
TCGGTACGGCCGTCGTCAGTGGCATCGCAGAGCGATACGCGCGCAACGGTGTCGAGTTCGCCGGCATCGTCCTTG
TCGCCGGCTTCAATGACCTCAAGTCTCTCATCGGAGAGTATCGTATCGGCGGGGTGCTGCCGTTGCTGGGCCCCT
TTTCCCTCTGGCCTAAGCTGGTCCGCAGGCTGGAGCGCTTCGTGGTCGATAATTGGCCCACTTCGAAACGACTGG
CCAGCATCGTGAGGCACACGAAGAAGAGGCTTCGCATCAGCCTGATCCATGCCAGCAACGACCGCGATATTCCCT
GCAGCGAGGACGACAAGCTCTTCCGCGCCGCGACCAACGAGACGGTTGGCATCGTCGACGACGCCGAGTTTGCGG
CCTGGAAGGAACAGCGCACGGTTCGTAAGCGCAAGGACGCCTTCGTGACGACCTGGACGGCGGATCCAGACATTA
TCGTCCGCCAAGAGCTGTTTCCGTACGGAGGTGAGTTGGCGCCTGGGATAGCTTCGACGCACGCTGACCAGCATC
GGCCAGGGCATGACCCCATCATGGGCTTTGCCCCGGTGGCGCTGGCCATCATGAGGTCCTTTGACTATCAGGGAA
CGGCATATGCGCAGACGACGGGTGATGAGAGGAGACCGTGGCTGAGCAGCTACTCGGAGGGATCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail