Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02357
Gene name
Locationscaffold_02:3452809..3454103
Strand+
Gene length (bp)1294
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16881 LIAS_N N-terminal domain of lipoyl synthase of Radical_SAM family 5.9E-18 85 138
PF04055 Radical_SAM Radical SAM superfamily 1.2E-12 162 324

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1778 0.1193 0.0375 0.0742 0.9334 0.1296 0.0504 0.0474 0.161 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6586
Ophiocordyceps australis map64 (Brazil) OphauB2|1500
Ophiocordyceps camponoti-floridani Ophcf2|02357 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|698
Ophiocordyceps kimflemingae Ophio5|3505
Ophiocordyceps subramaniannii Hirsu2|4227

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02357
MPHALTTSSLRCCVRVGSVVSRAFATVPLGKEARGCGEEAPPVRKTYFKNTTVASFSDFLAGSAAAAAAAASSEP
SSLAPSDAYELRTAEVGPAGRRRTITRLPEWLKTPIPNGGNYKKIKADLRGLGLHTVCEEARCPNISECWGGSDK
SAATATIMLMGDTCTRGCRFCSVKTSRTPPPLDVEEPEKTAEALARWGLGYVVLTSVDRDDLVDGGAAHFADTIR
RIKAKKAELLVEALTGDFAGNLDMVRLVAGSGLDVYAHNVETVEGLTPYVRDRRATFRQSINVLRHAKEAAADRG
IITKTSIMLGLGEQEAEVTDTLRELRRANVDVVTFGQYMRPTKRHLKVERYVTPAEFDSWRQRALDMGFLYCASG
PLVRSSYKAGEAFIENVLRKRAEEKAASSGGARC*
Coding >Ophcf2|02357
ATGCCCCACGCGCTGACGACGTCGTCGCTTCGCTGCTGCGTCCGCGTCGGCTCCGTTGTTTCTCGCGCTTTCGCC
ACCGTGCCGTTGGGTAAGGAGGCGAGGGGCTGTGGCGAAGAGGCGCCGCCAGTACGCAAGACGTATTTCAAGAAC
ACGACAGTCGCGTCGTTTTCCGATTTCTTGGCCGGATCGGCAGCAGCAGCAGCAGCAGCAGCATCATCAGAACCG
TCGTCGCTGGCTCCCTCCGACGCCTACGAGCTACGAACGGCAGAGGTCGGTCCGGCCGGTCGACGGCGCACCATC
ACCCGACTCCCCGAATGGCTCAAGACGCCCATCCCCAACGGCGGAAACTACAAGAAGATCAAGGCTGACCTGCGT
GGTTTGGGTCTACACACCGTCTGCGAGGAAGCGCGCTGTCCGAACATCTCGGAATGCTGGGGCGGATCCGACAAG
AGCGCTGCTACGGCGACCATCATGCTCATGGGCGACACGTGCACGCGCGGGTGCCGCTTCTGCAGCGTCAAGACG
AGCAGGACGCCTCCACCGCTGGATGTGGAGGAGCCGGAGAAGACGGCTGAGGCGTTGGCGCGCTGGGGGTTGGGA
TACGTTGTGTTGACGAGCGTTGATCGCGATGATCTTGTTGACGGGGGCGCTGCGCACTTTGCCGATACCATTCGA
AGGATAAAGGCTAAGAAGGCCGAGTTGTTGGTCGAGGCGCTGACGGGAGACTTTGCCGGCAATCTTGACATGGTT
CGCCTCGTTGCCGGTAGCGGACTCGATGTCTACGCCCACAATGTCGAGACGGTCGAGGGACTGACGCCCTATGTT
CGCGATCGGAGGGCTACCTTTCGTCAGAGCATCAACGTCCTCCGTCACGCCAAAGAAGCGGCCGCCGACCGCGGC
ATCATCACCAAAACGAGCATCATGCTCGGTCTAGGCGAGCAAGAAGCCGAAGTAACGGACACGCTTCGAGAGCTG
AGAAGAGCAAACGTCGACGTCGTCACCTTTGGCCAATACATGCGCCCTACAAAGCGCCACCTCAAGGTAGAGCGC
TACGTCACCCCCGCCGAATTCGATTCCTGGCGTCAGCGCGCTCTCGACATGGGCTTCCTCTACTGCGCCAGCGGG
CCGCTCGTTCGCTCGTCGTACAAGGCGGGCGAGGCCTTTATCGAGAATGTGCTGCGCAAGCGGGCTGAGGAGAAG
GCTGCTTCGAGTGGGGGGGCTCGCTGCTGA
Transcript >Ophcf2|02357
ATGCCCCACGCGCTGACGACGTCGTCGCTTCGCTGCTGCGTCCGCGTCGGCTCCGTTGTTTCTCGCGCTTTCGCC
ACCGTGCCGTTGGGTAAGGAGGCGAGGGGCTGTGGCGAAGAGGCGCCGCCAGTACGCAAGACGTATTTCAAGAAC
ACGACAGTCGCGTCGTTTTCCGATTTCTTGGCCGGATCGGCAGCAGCAGCAGCAGCAGCAGCATCATCAGAACCG
TCGTCGCTGGCTCCCTCCGACGCCTACGAGCTACGAACGGCAGAGGTCGGTCCGGCCGGTCGACGGCGCACCATC
ACCCGACTCCCCGAATGGCTCAAGACGCCCATCCCCAACGGCGGAAACTACAAGAAGATCAAGGCTGACCTGCGT
GGTTTGGGTCTACACACCGTCTGCGAGGAAGCGCGCTGTCCGAACATCTCGGAATGCTGGGGCGGATCCGACAAG
AGCGCTGCTACGGCGACCATCATGCTCATGGGCGACACGTGCACGCGCGGGTGCCGCTTCTGCAGCGTCAAGACG
AGCAGGACGCCTCCACCGCTGGATGTGGAGGAGCCGGAGAAGACGGCTGAGGCGTTGGCGCGCTGGGGGTTGGGA
TACGTTGTGTTGACGAGCGTTGATCGCGATGATCTTGTTGACGGGGGCGCTGCGCACTTTGCCGATACCATTCGA
AGGATAAAGGCTAAGAAGGCCGAGTTGTTGGTCGAGGCGCTGACGGGAGACTTTGCCGGCAATCTTGACATGGTT
CGCCTCGTTGCCGGTAGCGGACTCGATGTCTACGCCCACAATGTCGAGACGGTCGAGGGACTGACGCCCTATGTT
CGCGATCGGAGGGCTACCTTTCGTCAGAGCATCAACGTCCTCCGTCACGCCAAAGAAGCGGCCGCCGACCGCGGC
ATCATCACCAAAACGAGCATCATGCTCGGTCTAGGCGAGCAAGAAGCCGAAGTAACGGACACGCTTCGAGAGCTG
AGAAGAGCAAACGTCGACGTCGTCACCTTTGGCCAATACATGCGCCCTACAAAGCGCCACCTCAAGGTAGAGCGC
TACGTCACCCCCGCCGAATTCGATTCCTGGCGTCAGCGCGCTCTCGACATGGGCTTCCTCTACTGCGCCAGCGGG
CCGCTCGTTCGCTCGTCGTACAAGGCGGGCGAGGCCTTTATCGAGAATGTGCTGCGCAAGCGGGCTGAGGAGAAG
GCTGCTTCGAGTGGGGGGGCTCGCTGCTGA
Gene >Ophcf2|02357
ATGCCCCACGCGCTGACGACGTCGTCGCTTCGCTGCTGCGTCCGCGTCGGCTCCGTTGTTTCTCGCGCTTTCGCC
ACCGTGCCGTTGGGTAAGGAGGCGAGGGGCTGTGGCGAAGAGGCGCCGCCAGTACGCAAGACGTATTTCAAGAAC
ACGACAGTCGCGTCGTTTTCCGATTTCTTGGCCGGATCGGCAGCAGCAGCAGCAGCAGCAGCATCATCAGAACCG
TCGTCGCTGGCTCCCTCCGACGCCTACGAGCTACGAACGGCAGAGGTCGGTCCGGCCGGTCGACGGCGCACCATC
ACCCGACTCCCCGAATGGCTCAAGACGCCCATCCCCAACGGCGGAAACTACAAGAAGATCAAGGCTGACCTGCGT
GGTTTGGGTCTACACACCGTCTGCGAGGAAGCGCGCTGTCCGAACATCTCGGAATGCTGGGGCGGATCCGACAAG
AGCGCTGCTACGGCGACCATCATGCTCATGGGCGACACGTGCACGCGCGGGTGCCGCTTCTGCAGCGTCAAGACG
AGCAGGACGCCTCCACCGCTGGATGTGGAGGAGCCGGAGAAGACGGCTGAGGCGTTGGCGCGCTGGGGGTTGGGA
TACGTTGTGTTGACGAGCGTTGATCGCGATGATCTTGTTGACGGGGGCGCTGCGCACTTTGCCGATACCATTCGA
AGGATAAAGGCTAAGAAGGCCGAGTTGTTGGTCGAGGCGCTGACGGGAGACTTTGCCGGCAATCTTGACATGGTT
CGCCTCGTTGCCGGTAGCGGACTCGATGTCTACGCCCACAATGTCGAGACGGTCGAGGGACTGACGCCCTATGTT
CGCGATCGGAGGGCTACCTTTCGTCAGAGCATCAACGTCCTCCGTCACGCCAAAGAAGCGGCCGCCGACCGCGGC
ATCATCACCAAAACGAGCATCATGCTCGGTCTAGGCGAGCAAGAAGCCGAAGTAACGGACACGCTTCGAGGTGAG
AGCGAACCCTCCCGAAAAGAACATACCAAAACCCAGGAACTCACCCCTAACCCACACAGAGCTGAGAAGAGCAAA
CGTCGACGTCGTCACCTTTGGCCAATACATGCGCCCTACAAAGCGCCACCTCAAGGTAGAGCGCTACGTCACCCC
CGCCGAATTCGATTCCTGGCGTCAGCGCGCTCTCGACATGGGCTTCCTCTACTGCGCCAGCGGGCCGCTCGTTCG
CTCGTCGTACAAGGCGGGCGAGGCCTTTATCGAGAATGTGCTGCGCAAGCGGGCTGAGGAGAAGGCTGCTTCGAG
TGGGGGGGCTCGCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail