Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02354
Gene name
Locationscaffold_02:3442474..3444104
Strand-
Gene length (bp)1630
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-26 72 315
PF13506 Glyco_transf_21 Glycosyl transferase family 21 3.5E-07 141 315
PF00535 Glycos_transf_2 Glycosyl transferase family 2 3.4E-06 74 251

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 342 364 22
2 376 398 22
3 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 11.47 4.86 18.07
Alive In ants, during behavior modification 13.28 5.77 20.80
Dead In ants, recently dead 29.31 15.42 43.20

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.611958 no
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02354
MNDAAVAQLLAGIAGRALVRLINSPRTSPLAWAIVFWILWIHRYLRLLVHCVSHWTYKSKPIPEKPSYTSREVTV
VIPTIHNVFEELRPSIESILICDPQELILVTTDPKRAELEKLAASLRVYDGNDKRCNRVSVYSTPIANKRLQVRE
ALPHVKTEITIMADDDVTWPTTMLPWILAPFEDKDMGGVGTCQRAKRDRSGSVASSIWNWLGAAYIERRNFEISA
THNIDGGTSCMSGRTGAYRTSILQKYDFLDGLINEKWRRWILNADDDNFVTRWLVSHQWKTWVQYEPECELETTL
ENNTKFLYQCTRWARSNWRSNWTSLVQERYVWTQQPWCTYALHFATFTSLAFVVDALLLVSCWLATSEWELYQRR
WAFWSLFVFIFAFTKTVKLVGLWRRHPVDIIFLPVSIAFGYFHGLIKLYALLTLNMTSWGSRADGDADNDKRLVN
LLPRADVLQNPDGTALVRYNDECPGIDPPRGRDHTKRMMPTAKPAVGQVPS*
Coding >Ophcf2|02354
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCGGGAATCGCGGGCCGTGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACCTCGCCCCTCGCATGGGCCATTGTGTTTTGGATCCTCTGGATCCATCGCTACCTGCGTCTGCTCGTCCAT
TGCGTCAGTCACTGGACCTACAAGTCGAAGCCGATCCCGGAGAAGCCAAGCTACACGTCCCGAGAAGTCACGGTT
GTGATTCCAACCATCCACAACGTCTTTGAAGAGCTGCGACCGTCGATCGAGAGTATCCTCATCTGCGACCCCCAA
GAGCTGATCCTGGTGACGACGGATCCCAAGCGGGCCGAGCTCGAGAAGCTGGCGGCCTCGCTCCGTGTCTACGAT
GGCAACGACAAGCGCTGCAACCGCGTGAGCGTCTACAGCACCCCCATCGCCAACAAACGGCTTCAGGTACGAGAG
GCTCTCCCTCACGTGAAGACGGAGATCACCATCATGGCCGACGACGACGTCACCTGGCCGACGACGATGCTCCCC
TGGATCCTGGCCCCCTTTGAGGACAAGGACATGGGAGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACAGGTCC
GGCTCCGTAGCCTCAAGCATCTGGAACTGGCTCGGGGCGGCTTATATCGAGCGGCGCAACTTTGAGATATCGGCC
ACGCACAACATTGATGGAGGCACCTCGTGTATGTCGGGTCGGACGGGAGCCTACCGAACGTCCATCCTTCAGAAG
TACGACTTCCTCGATGGCCTCATCAACGAGAAGTGGCGTCGCTGGATCCTCAACGCCGACGACGACAACTTCGTC
ACCCGCTGGCTCGTCTCTCACCAGTGGAAGACTTGGGTTCAGTACGAGCCCGAGTGCGAGCTCGAGACCACGCTG
GAGAACAACACCAAGTTCCTGTATCAGTGTACGCGTTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGCCTC
GTACAGGAGCGTTACGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTTCACTTCGCCACTTTTACCTCGCTG
GCCTTTGTCGTCGATGCGCTGCTTCTCGTCTCGTGCTGGCTGGCTACGTCGGAGTGGGAGCTTTACCAGCGCCGG
TGGGCGTTTTGGTCGCTCTTCGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTCGGCCTTTGGAGGCGT
CATCCCGTCGACATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTGATCAAGCTGTACGCT
CTGTTGACGCTGAACATGACTTCCTGGGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTCGTCAAT
CTTCTCCCGCGCGCCGACGTGCTGCAGAACCCCGATGGTACGGCCCTGGTCCGTTACAATGACGAATGCCCCGGC
ATCGATCCGCCCCGAGGCCGGGATCACACTAAGAGGATGATGCCCACGGCCAAGCCTGCAGTTGGTCAAGTGCCG
TCGTGA
Transcript >Ophcf2|02354
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCGGGAATCGCGGGCCGTGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACCTCGCCCCTCGCATGGGCCATTGTGTTTTGGATCCTCTGGATCCATCGCTACCTGCGTCTGCTCGTCCAT
TGCGTCAGTCACTGGACCTACAAGTCGAAGCCGATCCCGGAGAAGCCAAGCTACACGTCCCGAGAAGTCACGGTT
GTGATTCCAACCATCCACAACGTCTTTGAAGAGCTGCGACCGTCGATCGAGAGTATCCTCATCTGCGACCCCCAA
GAGCTGATCCTGGTGACGACGGATCCCAAGCGGGCCGAGCTCGAGAAGCTGGCGGCCTCGCTCCGTGTCTACGAT
GGCAACGACAAGCGCTGCAACCGCGTGAGCGTCTACAGCACCCCCATCGCCAACAAACGGCTTCAGGTACGAGAG
GCTCTCCCTCACGTGAAGACGGAGATCACCATCATGGCCGACGACGACGTCACCTGGCCGACGACGATGCTCCCC
TGGATCCTGGCCCCCTTTGAGGACAAGGACATGGGAGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACAGGTCC
GGCTCCGTAGCCTCAAGCATCTGGAACTGGCTCGGGGCGGCTTATATCGAGCGGCGCAACTTTGAGATATCGGCC
ACGCACAACATTGATGGAGGCACCTCGTGTATGTCGGGTCGGACGGGAGCCTACCGAACGTCCATCCTTCAGAAG
TACGACTTCCTCGATGGCCTCATCAACGAGAAGTGGCGTCGCTGGATCCTCAACGCCGACGACGACAACTTCGTC
ACCCGCTGGCTCGTCTCTCACCAGTGGAAGACTTGGGTTCAGTACGAGCCCGAGTGCGAGCTCGAGACCACGCTG
GAGAACAACACCAAGTTCCTGTATCAGTGTACGCGTTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGCCTC
GTACAGGAGCGTTACGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTTCACTTCGCCACTTTTACCTCGCTG
GCCTTTGTCGTCGATGCGCTGCTTCTCGTCTCGTGCTGGCTGGCTACGTCGGAGTGGGAGCTTTACCAGCGCCGG
TGGGCGTTTTGGTCGCTCTTCGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTCGGCCTTTGGAGGCGT
CATCCCGTCGACATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTGATCAAGCTGTACGCT
CTGTTGACGCTGAACATGACTTCCTGGGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTCGTCAAT
CTTCTCCCGCGCGCCGACGTGCTGCAGAACCCCGATGGTACGGCCCTGGTCCGTTACAATGACGAATGCCCCGGC
ATCGATCCGCCCCGAGGCCGGGATCACACTAAGAGGATGATGCCCACGGCCAAGCCTGCAGTTGGTCAAGTGCCG
TCGTGA
Gene >Ophcf2|02354
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCGGGAATCGCGGGCCGTGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACCTCGCCCCTCGCATGGGCCATTGTGTTTTGGATCCTCTGGTAAGAAGAAGAGAGTGAGTTGGGTGTCAAG
GAACTAGGTCAACTGACTTGTTCTCGACAACAGGATCCATCGCTACCTGCGTCTGCTCGTCCATTGCGTCAGTCA
CTGGACCTACAAGTCGAAGCCGATCCCGGAGAAGCCAAGCTACACGTCCCGAGAAGTCACGGTTGTGATTCCAAC
CATCCACAACGTCTTTGAAGAGCTGCGACCGTCGATCGAGAGTATCCTCATCTGCGACCCCCAAGAGCTGATCCT
GGTGACGACGGATCCCAAGCGGGCCGAGCTCGAGAAGCTGGCGGCCTCGCTCCGTGTCTACGATGGCAACGACAA
GCGCTGCAACCGCGTGAGCGTCTACAGCACCCCCATCGCCAACAAACGGCTTCAGGTACGAGAGGCTCTCCCTCA
CGTGAAGACGGAGATCACCATCATGGCCGACGACGACGTCACCTGGCCGACGACGATGCTCCCCTGGATCCTGGC
CCCCTTTGAGGACAAGGACATGGGAGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACAGGTCCGGCTCCGTAGC
CTCAAGCATCTGGAACTGGCTCGGGGCGGCTTATATCGAGCGGCGCAACTTTGAGATATCGGCCACGCACAACAT
TGATGGAGGCACCTCGTGTATGTCGGGTCGGACGGGAGCCTACCGAACGTCCATCCTTCAGAAGTACGACTTCCT
CGATGGCCTCATCAACGAGAAGTGGCGTCGCTGGATCCTCAACGCCGACGACGACAACTTCGTCACCCGCTGGCT
CGTCTCTCACCAGTGGAAGACTTGGGTTCAGTACGAGCCCGAGTGCGAGCTCGAGACCACGCTGGAGAACAACAC
CAAGTTCCTGTATCAGTGTACGCGTTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGCCTCGTACAGGAGCG
TTACGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTTCACTTCGCCACTTTTACCTCGCTGGCCTTTGTCGT
CGATGCGCTGCTTCTCGTCTCGTGCTGGCTGGCTACGTCGGAGTGGGAGCTTTACCAGCGCCGGTGGGCGTTTTG
GTCGCTCTTCGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTCGGCCTTTGGAGGCGTCATCCCGTCGA
CATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTGATCAAGCTGTACGCTCTGTTGACGCT
GAACATGGTGAGTGACATACAATCTTTACAGACATGGACCCGTAAACTGACTGACCTCCTCTTTCAGACTTCCTG
GGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTCGTCAATCTTCTCCCGCGCGCCGACGTGCTGCA
GAACCCCGATGGTACGGCCCTGGTCCGTTACAATGACGAATGCCCCGGCATCGATCCGCCCCGAGGCCGGGATCA
CACTAAGAGGATGATGCCCACGGCCAAGCCTGCAGTTGGTCAAGTGCCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail