Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02350
Gene name
Locationscaffold_02:3426005..3428537
Strand-
Gene length (bp)2532
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.6E-20 95 249
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 6.1E-19 572 714

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 69 86 17
2 91 113 22
3 126 148 22
4 158 180 22
5 192 214 22
6 229 247 18
7 569 591 22
8 606 628 22
9 635 657 22
10 667 689 22
11 696 718 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02350
MKEDPPDIEACRDAPTGPLSAEKPVVGSNAEMASTMTTTTTTTTTKTSGKLSRGFVAELRRSFHMVATYSWLNVL
LLFVPIGIAVANIKGVHGGIVFAMNCIAIVPLAGLLSFATESVATNMGDSLGALLNVTFGNAVELIIFIIALVKD
QIRIVQASLLGSILANLLLILGMGFFLGGLRYREQVYNSTVTQVSACLLSLSVISLMLPTAFHASFNDRRRADEE
SLKISRGTSVILLLVYVIYLLFQLKSHAYMYESTPQHIVDAEAIPGPAAAWLETSSSDNCSSASDDSDDSDHSRD
TMRRKMKKVLRGGRRRKSSTASTDTGELSAIRNGSLGIVNGSAIDEMTSEVSLKRPVPISREASDETEEVVEDEK
PRKRKRHHRLPHRHHRRRHGKHRHDSLDHPETDTARTGAATSAGEPHRVDFATRAGGGRGIIAPGSAAPTAAAAA
AATTNAATETPSQAPKSRPFPAFRGMSVKSLTPTVFAQRPETVVATPQSRPGPVPRVRYGIRRTNSLPDRLRNQF
QGRPPGAMFPARPSLTGTSTSAGVGPRSNEDGENEESPPHLSRSAAVILLLMTTGLVAVCAEFLVGSIEAVTRTS
TIGEIFIGLIILPIVGNAAEHVTAITVAMKNKMDLAIGVAVGSSIQIALFVTPLVVILGWIIGREMSLFFTLFET
VSLFASAFIVNFLVLDGRSNYLEGALLCAVYVIIAIVAFFFPSERETSTWGS*
Coding >Ophcf2|02350
ATGAAGGAAGACCCGCCTGACATAGAGGCCTGTCGCGATGCTCCGACCGGTCCTTTGTCCGCGGAGAAGCCCGTC
GTCGGTTCCAACGCGGAGATGGCATCGACGATGACGACGACGACGACGACGACGACGACGAAGACGAGTGGGAAG
TTGTCGAGAGGCTTCGTCGCTGAGCTTCGGCGTTCCTTTCACATGGTCGCCACCTACAGCTGGCTCAACGTGCTT
CTCCTATTCGTGCCCATTGGCATCGCCGTCGCCAATATCAAGGGGGTCCATGGAGGCATCGTCTTCGCCATGAAT
TGCATTGCCATTGTGCCGCTCGCTGGTCTGTTGAGCTTTGCTACCGAGTCGGTCGCTACGAACATGGGTGATTCA
TTGGGGGCTCTGCTCAACGTGACGTTTGGCAACGCCGTTGAGCTCATCATCTTCATAATCGCTCTCGTCAAGGAC
CAAATCCGCATCGTCCAGGCCTCTCTGCTCGGCTCCATCTTGGCCAACCTCTTGCTGATTCTCGGCATGGGCTTC
TTCCTCGGCGGTCTGCGGTACCGCGAGCAGGTCTATAACAGCACCGTGACGCAAGTCAGTGCCTGTCTGCTCAGC
CTGAGCGTCATCAGTCTCATGCTGCCGACGGCCTTCCACGCGTCCTTCAACGACCGCCGACGCGCCGACGAGGAG
TCTTTGAAAATCAGTCGCGGAACCAGCGTGATCCTCCTTCTCGTATACGTCATCTACCTGCTCTTCCAGCTCAAG
TCGCACGCCTACATGTATGAGTCGACGCCCCAGCACATCGTCGACGCAGAGGCCATCCCTGGTCCCGCCGCCGCC
TGGCTCGAGACGTCGAGTTCGGACAACTGTTCGTCCGCCAGCGACGATTCAGACGACTCGGATCACTCGCGGGAC
ACGATGAGGCGCAAGATGAAAAAGGTGCTGCGCGGCGGCCGGAGGCGCAAGTCTTCCACCGCCTCGACGGACACG
GGTGAATTGAGCGCCATCCGCAACGGCTCGCTCGGCATCGTCAACGGAAGCGCCATCGACGAGATGACGTCGGAG
GTCTCTTTGAAGCGACCCGTGCCAATATCGCGCGAGGCGTCGGACGAGACGGAGGAGGTCGTCGAAGATGAGAAG
CCTCGCAAGCGCAAGAGGCATCACCGTCTCCCCCATCGCCACCACAGGCGCCGTCACGGGAAGCATCGTCACGAC
AGCCTTGACCATCCGGAGACGGACACGGCCCGTACCGGCGCTGCCACTTCTGCCGGGGAACCGCACCGGGTCGAC
TTTGCTACGCGCGCGGGCGGTGGGCGCGGCATCATCGCCCCCGGTTCGGCCGCTCCCACGGCTGCGGCTGCGGCT
GCGGCGACGACGAATGCGGCGACGGAGACTCCGAGTCAAGCTCCCAAGAGCAGACCGTTCCCTGCCTTCCGCGGC
ATGTCGGTCAAGAGCCTGACGCCGACCGTCTTCGCCCAGAGACCCGAGACGGTGGTGGCGACGCCTCAATCTCGG
CCCGGGCCAGTGCCTCGCGTGCGGTACGGCATCCGGCGCACAAACTCGCTCCCGGACCGGCTGAGGAACCAGTTC
CAAGGCCGCCCCCCCGGGGCCATGTTTCCCGCGCGGCCTTCGTTGACGGGCACCAGCACCAGCGCAGGCGTCGGC
CCGAGGTCGAACGAGGACGGCGAGAACGAGGAATCTCCGCCGCACCTCTCGCGGTCGGCGGCCGTGATTCTTCTT
CTGATGACTACGGGTCTCGTGGCTGTCTGCGCCGAGTTTTTGGTGGGCTCCATCGAGGCGGTGACGAGGACGTCG
ACGATTGGTGAGATCTTCATCGGGCTCATCATCCTGCCCATCGTCGGCAACGCGGCGGAGCACGTGACGGCCATC
ACGGTGGCCATGAAGAACAAGATGGACCTGGCGATTGGGGTGGCGGTTGGCAGCTCTATCCAGATTGCGCTGTTC
GTGACGCCGCTGGTGGTGATTTTGGGCTGGATCATCGGGCGAGAGATGTCGCTCTTCTTCACGCTGTTCGAGACG
GTCAGCCTGTTCGCGTCGGCCTTTATCGTCAACTTTCTGGTGCTGGACGGGCGCAGCAACTATCTCGAAGGGGCG
CTGCTGTGTGCCGTCTACGTCATCATTGCCATCGTCGCGTTTTTCTTTCCGAGCGAGCGGGAGACGAGCACGTGG
GGGAGTTAG
Transcript >Ophcf2|02350
ATGAAGGAAGACCCGCCTGACATAGAGGCCTGTCGCGATGCTCCGACCGGTCCTTTGTCCGCGGAGAAGCCCGTC
GTCGGTTCCAACGCGGAGATGGCATCGACGATGACGACGACGACGACGACGACGACGACGAAGACGAGTGGGAAG
TTGTCGAGAGGCTTCGTCGCTGAGCTTCGGCGTTCCTTTCACATGGTCGCCACCTACAGCTGGCTCAACGTGCTT
CTCCTATTCGTGCCCATTGGCATCGCCGTCGCCAATATCAAGGGGGTCCATGGAGGCATCGTCTTCGCCATGAAT
TGCATTGCCATTGTGCCGCTCGCTGGTCTGTTGAGCTTTGCTACCGAGTCGGTCGCTACGAACATGGGTGATTCA
TTGGGGGCTCTGCTCAACGTGACGTTTGGCAACGCCGTTGAGCTCATCATCTTCATAATCGCTCTCGTCAAGGAC
CAAATCCGCATCGTCCAGGCCTCTCTGCTCGGCTCCATCTTGGCCAACCTCTTGCTGATTCTCGGCATGGGCTTC
TTCCTCGGCGGTCTGCGGTACCGCGAGCAGGTCTATAACAGCACCGTGACGCAAGTCAGTGCCTGTCTGCTCAGC
CTGAGCGTCATCAGTCTCATGCTGCCGACGGCCTTCCACGCGTCCTTCAACGACCGCCGACGCGCCGACGAGGAG
TCTTTGAAAATCAGTCGCGGAACCAGCGTGATCCTCCTTCTCGTATACGTCATCTACCTGCTCTTCCAGCTCAAG
TCGCACGCCTACATGTATGAGTCGACGCCCCAGCACATCGTCGACGCAGAGGCCATCCCTGGTCCCGCCGCCGCC
TGGCTCGAGACGTCGAGTTCGGACAACTGTTCGTCCGCCAGCGACGATTCAGACGACTCGGATCACTCGCGGGAC
ACGATGAGGCGCAAGATGAAAAAGGTGCTGCGCGGCGGCCGGAGGCGCAAGTCTTCCACCGCCTCGACGGACACG
GGTGAATTGAGCGCCATCCGCAACGGCTCGCTCGGCATCGTCAACGGAAGCGCCATCGACGAGATGACGTCGGAG
GTCTCTTTGAAGCGACCCGTGCCAATATCGCGCGAGGCGTCGGACGAGACGGAGGAGGTCGTCGAAGATGAGAAG
CCTCGCAAGCGCAAGAGGCATCACCGTCTCCCCCATCGCCACCACAGGCGCCGTCACGGGAAGCATCGTCACGAC
AGCCTTGACCATCCGGAGACGGACACGGCCCGTACCGGCGCTGCCACTTCTGCCGGGGAACCGCACCGGGTCGAC
TTTGCTACGCGCGCGGGCGGTGGGCGCGGCATCATCGCCCCCGGTTCGGCCGCTCCCACGGCTGCGGCTGCGGCT
GCGGCGACGACGAATGCGGCGACGGAGACTCCGAGTCAAGCTCCCAAGAGCAGACCGTTCCCTGCCTTCCGCGGC
ATGTCGGTCAAGAGCCTGACGCCGACCGTCTTCGCCCAGAGACCCGAGACGGTGGTGGCGACGCCTCAATCTCGG
CCCGGGCCAGTGCCTCGCGTGCGGTACGGCATCCGGCGCACAAACTCGCTCCCGGACCGGCTGAGGAACCAGTTC
CAAGGCCGCCCCCCCGGGGCCATGTTTCCCGCGCGGCCTTCGTTGACGGGCACCAGCACCAGCGCAGGCGTCGGC
CCGAGGTCGAACGAGGACGGCGAGAACGAGGAATCTCCGCCGCACCTCTCGCGGTCGGCGGCCGTGATTCTTCTT
CTGATGACTACGGGTCTCGTGGCTGTCTGCGCCGAGTTTTTGGTGGGCTCCATCGAGGCGGTGACGAGGACGTCG
ACGATTGGTGAGATCTTCATCGGGCTCATCATCCTGCCCATCGTCGGCAACGCGGCGGAGCACGTGACGGCCATC
ACGGTGGCCATGAAGAACAAGATGGACCTGGCGATTGGGGTGGCGGTTGGCAGCTCTATCCAGATTGCGCTGTTC
GTGACGCCGCTGGTGGTGATTTTGGGCTGGATCATCGGGCGAGAGATGTCGCTCTTCTTCACGCTGTTCGAGACG
GTCAGCCTGTTCGCGTCGGCCTTTATCGTCAACTTTCTGGTGCTGGACGGGCGCAGCAACTATCTCGAAGGGGCG
CTGCTGTGTGCCGTCTACGTCATCATTGCCATCGTCGCGTTTTTCTTTCCGAGCGAGCGGGAGACGAGCACGTGG
GGGAGTTAG
Gene >Ophcf2|02350
ATGAAGGAAGACCCGCCTGACATAGAGGCCTGTCGCGATGCTCCGACCGGTCCTTTGTCCGCGGAGAAGCCCGTC
GTCGGTTCCAACGCGGAGATGGCATCGACGATGACGACGACGACGACGACGACGACGACGAAGACGAGTGGGAAG
TTGTCGAGAGGCTTCGTCGCTGAGCTTCGGCGTTCCTTTCACATGGTCGCCACCTACAGCTGGCTCAACGTGCTT
CTCCTATTCGTGCCCATTGGCATCGCCGTCGCCAATATCAAGGGGGTCCATGGAGGCATCGTCTTCGCCATGAAT
TGCATTGCCATTGTGCCGCTCGCTGGTCTGTTGAGCTTTGCTACCGAGTCGGTCGCTACGAACATGGGTGATTCA
TTGGGGGCTCTGCTCAACGTGACGTTTGGCAACGCCGTTGAGCTCATCATCTTGTGCGTTGGCTGCCTTTGGTTG
TGTGAATGAGAGCTCTGACTAACGAATTCTGCCAGCATGTAAGTCGCGGGCTGCCACGCGTGTGAAGCAACTTTG
ACCTGACTGGGCCGACGCCTGCAGAATCGCTCTCGTCAAGGTGTGTGCGCTCCAACATTCGGGCTGCACGAGTCT
TTAGCTGACGAGAACCAGGACCAAATCCGCATCGTCCAGGCCTCTCTGCTCGGCTCCATCTTGGCCAACCTCTTG
CTGATTCTCGGCATGGGCTTCTTCCTCGGCGGTCTGCGGTACCGCGAGCAGGTGCGGCTTCGTCGTCGCCATCAG
CCACTTCAAGATGCTGACCTTGATAGGTCTATAACAGCACCGTGACGCAAGTCAGTGCCTGTCTGCTCAGCCTGA
GCGTCATCAGTCTCATGCTGCCGGTGAGGTTCCCTCTTCCGTCACGACTCCGACTATGCAACTCACTCACGCGTG
CCAAGACGGCCTTCCACGCGTCCTTCAACGACCGCCGACGCGCCGACGAGGAGTCTTTGAAAATCAGTCGCGGAA
CCAGCGTGGTGAGTCTTGTCGCTGCTGTCTAGGTGAACCTCCTTCCGTTGACACTTCTTTCTCTCTCCTCCACGG
CAGATCCTCCTTCTCGTATACGTCATCTACCTGCTCTTCCAGCTCAAGTCGCACGCCTACATGTATGAGTCGACG
CCCCAGCACATCGTCGACGCAGAGGCCATCCCTGGTCCCGCCGCCGCCTGGCTCGAGACGTCGAGTTCGGACAAC
TGTTCGTCCGCCAGCGACGATTCAGACGACTCGGATCACTCGCGGGACACGATGAGGCGCAAGATGAAAAAGGTG
CTGCGCGGCGGCCGGAGGCGCAAGTCTTCCACCGCCTCGACGGACACGGGTGAATTGAGCGCCATCCGCAACGGC
TCGCTCGGCATCGTCAACGGAAGCGCCATCGACGAGATGACGTCGGAGGTCTCTTTGAAGCGACCCGTGCCAATA
TCGCGCGAGGCGTCGGACGAGACGGAGGAGGTCGTCGAAGATGAGAAGCCTCGCAAGCGCAAGAGGCATCACCGT
CTCCCCCATCGCCACCACAGGCGCCGTCACGGGAAGCATCGTCACGACAGCCTTGACCATCCGGAGACGGACACG
GCCCGTACCGGCGCTGCCACTTCTGCCGGGGAACCGCACCGGGTCGACTTTGCTACGCGCGCGGGCGGTGGGCGC
GGCATCATCGCCCCCGGTTCGGCCGCTCCCACGGCTGCGGCTGCGGCTGCGGCGACGACGAATGCGGCGACGGAG
ACTCCGAGTCAAGCTCCCAAGAGCAGACCGTTCCCTGCCTTCCGCGGCATGTCGGTCAAGAGCCTGACGCCGACC
GTCTTCGCCCAGAGACCCGAGACGGTGGTGGCGACGCCTCAATCTCGGCCCGGGCCAGTGCCTCGCGTGCGGTAC
GGCATCCGGCGCACAAACTCGCTCCCGGACCGGCTGAGGAACCAGTTCCAAGGCCGCCCCCCCGGGGCCATGTTT
CCCGCGCGGCCTTCGTTGACGGGCACCAGCACCAGCGCAGGCGTCGGCCCGAGGTCGAACGAGGACGGCGAGAAC
GAGGAATCTCCGCCGCACCTCTCGCGGTCGGCGGCCGTGATTCTTCTTCTGATGACTACGGGTCTCGTGGCTGTC
TGCGCCGAGTTTTTGGTGGGCTCCATCGAGGCGGTGACGAGGACGTCGACGATTGGTGAGATCTTCATCGGGCTC
ATCATCCTGCCCATCGTCGGCAACGCGGCGGAGCACGTGACGGCCATCACGGTGGCCATGAAGAACAAGATGGAC
CTGGCGATTGGGGTGGCGGTTGGCAGCTCTATCCAGATTGCGCTGTTCGTGACGCCGCTGGTGGTGATTTTGGGC
TGGATCATCGGGCGAGAGATGTCGCTCTTCTTCACGCTGTTCGAGACGGTCAGCCTGTTCGCGTCGGCCTTTATC
GTCAACTTTCTGGTGCTGGACGGGCGCAGCAACTATCTCGAAGGGGCGCTGCTGTGTGCCGTCTACGTCATCATT
GCCATCGTCGCGTTTTTCTTTCCGAGCGAGCGGGAGACGAGCACGTGGGGGAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail