Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02343
Gene name
Locationscaffold_02:3409195..3411288
Strand-
Gene length (bp)2093
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 162 184 22
2 208 227 19
3 234 256 22
4 288 310 22
5 336 358 22
6 368 387 19
7 394 412 18
8 432 454 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.52 31.59 79.45
Alive In ants, during behavior modification 112.26 62.65 161.87
Dead In ants, recently dead 83.47 47.87 119.07

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.063972 no
Dead Fungus 0.025389 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02343
MPALFLQVPTATPSSVNYCVIARATPPPGPWLNVSFALFSVQHHAPVSRSVLAPPSFSSLDLLFIHHRHSHQSSR
LQSLVQPALAQSPVLATRTSSLDYNSKYSREFGQAYPQPAYSQPAYAENANLNAGFDQGYAYRQGLASSNPARSV
YRDRMSFLKSKWPAAFMAVASLQAIVCLAFESFVFASFQSSLGRYDNKPDVQSQYKTIPTFLTLIIFGFLYELVV
VWDALRMKNTIQVIGVCIANLALLVYTAIQVDQIQMAISTLGIAALKPGITPDQVWSQLRPFLVAIPAIIALATA
AMVFIAWKLYQEFAWDILKNIGADYRMKKRFLHYQIYIALLKFDFFFFLGFIIQFVVIVAQKTDPEFALTIATIP
VTICILLAAAYFTRRENKLGMMAVIILYLGGLIYFIFKLVRIYQPAYRLFYLPVRKSLTAFAVITILLILLTIAN
AVICMGNFDKGLKAHLLTPRRMDEKPDAHSISLHDVKPQIPSRMTID*
Coding >Ophcf2|02343
ATGCCCGCCCTCTTCCTCCAAGTTCCCACTGCTACCCCTTCCAGCGTCAACTACTGTGTCATCGCGCGCGCGACG
CCACCGCCGGGGCCTTGGTTGAACGTTTCGTTCGCACTGTTCTCGGTACAACATCACGCGCCCGTTTCCCGCTCC
GTTCTTGCGCCACCCTCATTCTCCTCCTTGGACCTCCTGTTTATTCATCATCGTCACTCTCATCAATCATCTCGT
CTTCAGTCTCTCGTTCAGCCGGCACTCGCCCAGTCGCCCGTCCTGGCTACCAGGACGTCGTCTCTCGATTACAAC
TCAAAGTACTCGCGCGAATTCGGACAGGCCTACCCGCAGCCCGCATACTCGCAGCCCGCCTACGCGGAGAATGCC
AATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGGCCTGGCCTCTTCCAATCCGGCCAGGAGTGTC
TACCGCGACAGGATGAGCTTCCTCAAGTCGAAATGGCCCGCCGCCTTCATGGCCGTCGCCAGTCTCCAGGCCATC
GTTTGCCTGGCATTTGAGTCATTTGTCTTTGCTTCCTTCCAGTCGAGCCTCGGCCGTTATGACAACAAGCCCGAT
GTTCAATCCCAGTACAAGACGATTCCCACCTTTTTGACCCTCATCATCTTTGGCTTCCTGTACGAGCTGGTCGTC
GTCTGGGATGCGCTGCGAATGAAAAACACCATCCAGGTCATTGGCGTCTGCATCGCCAACCTGGCCCTGCTCGTC
TACACCGCCATCCAGGTCGACCAGATCCAGATGGCCATCAGCACCCTCGGTATCGCCGCCTTGAAGCCCGGCATC
ACCCCGGACCAGGTCTGGTCTCAGCTGAGGCCCTTCCTCGTCGCCATCCCTGCCATCATCGCCCTCGCCACCGCC
GCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGACATTCTCAAGAACATTGGCGCCGACTAT
CGCATGAAGAAGCGCTTCCTCCATTATCAGATCTACATTGCCCTCCTCAAGTTCGACTTCTTCTTCTTCCTCGGC
TTCATCATCCAATTCGTCGTCATCGTCGCCCAAAAGACCGATCCCGAGTTCGCCCTGACCATCGCCACCATCCCC
GTCACCATCTGCATCCTCCTCGCCGCCGCCTACTTCACTCGCCGCGAGAACAAGCTCGGCATGATGGCCGTCATC
ATCCTCTACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGCATCTACCAGCCCGCCTACAGGCTCTTC
TACCTGCCCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATCCTATTGATCCTCCTCACCATTGCAAAC
GCCGTCATCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTGCTGACCCCCCGCCGGATGGACGAGAAG
CCGGATGCACACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCCAGCCGGATGACCATCGACTGA
Transcript >Ophcf2|02343
ATGCCCGCCCTCTTCCTCCAAGTTCCCACTGCTACCCCTTCCAGCGTCAACTACTGTGTCATCGCGCGCGCGACG
CCACCGCCGGGGCCTTGGTTGAACGTTTCGTTCGCACTGTTCTCGGTACAACATCACGCGCCCGTTTCCCGCTCC
GTTCTTGCGCCACCCTCATTCTCCTCCTTGGACCTCCTGTTTATTCATCATCGTCACTCTCATCAATCATCTCGT
CTTCAGTCTCTCGTTCAGCCGGCACTCGCCCAGTCGCCCGTCCTGGCTACCAGGACGTCGTCTCTCGATTACAAC
TCAAAGTACTCGCGCGAATTCGGACAGGCCTACCCGCAGCCCGCATACTCGCAGCCCGCCTACGCGGAGAATGCC
AATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGGCCTGGCCTCTTCCAATCCGGCCAGGAGTGTC
TACCGCGACAGGATGAGCTTCCTCAAGTCGAAATGGCCCGCCGCCTTCATGGCCGTCGCCAGTCTCCAGGCCATC
GTTTGCCTGGCATTTGAGTCATTTGTCTTTGCTTCCTTCCAGTCGAGCCTCGGCCGTTATGACAACAAGCCCGAT
GTTCAATCCCAGTACAAGACGATTCCCACCTTTTTGACCCTCATCATCTTTGGCTTCCTGTACGAGCTGGTCGTC
GTCTGGGATGCGCTGCGAATGAAAAACACCATCCAGGTCATTGGCGTCTGCATCGCCAACCTGGCCCTGCTCGTC
TACACCGCCATCCAGGTCGACCAGATCCAGATGGCCATCAGCACCCTCGGTATCGCCGCCTTGAAGCCCGGCATC
ACCCCGGACCAGGTCTGGTCTCAGCTGAGGCCCTTCCTCGTCGCCATCCCTGCCATCATCGCCCTCGCCACCGCC
GCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGACATTCTCAAGAACATTGGCGCCGACTAT
CGCATGAAGAAGCGCTTCCTCCATTATCAGATCTACATTGCCCTCCTCAAGTTCGACTTCTTCTTCTTCCTCGGC
TTCATCATCCAATTCGTCGTCATCGTCGCCCAAAAGACCGATCCCGAGTTCGCCCTGACCATCGCCACCATCCCC
GTCACCATCTGCATCCTCCTCGCCGCCGCCTACTTCACTCGCCGCGAGAACAAGCTCGGCATGATGGCCGTCATC
ATCCTCTACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGCATCTACCAGCCCGCCTACAGGCTCTTC
TACCTGCCCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATCCTATTGATCCTCCTCACCATTGCAAAC
GCCGTCATCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTGCTGACCCCCCGCCGGATGGACGAGAAG
CCGGATGCACACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCCAGCCGGATGACCATCGACTGA
Gene >Ophcf2|02343
ATGCCCGCCCTCTTCCTCCAAGTTCCCACTGCTGTAACCTCATTTCGCCCAGGGGTTCCCCTACCATCCATTCAT
CCCCCGGCTCCCCCTTGGCCGTCGTCGTCGGTCTGATAGGCCGGTCCTTGCTCCACGTCCAGGTTACAGTGCGCG
TAGACCCCTTCCAGCGTCAACTACTGTGTCATCGCGCGCGCGACGCCACCGCCGGGGCCTTGGTTGAACGTTTCG
TTCGCACTGTTCTCGGTACAACATCACGCGCCCGTTTCCCGCTCCGTTCTTGCGCCACCCTCATTCTCCTCCTTG
GACCTCCTGTTTATTCATCATCGTCACTCTCATCAATCATCTCGTCTTCAGTCTCTCGTTCAGCCGGCACGTCTG
TCATCTATCGTTTTTTTTTTTTTTTTTTTCACTCGGGTCCGCTCCTCTGAGAATCTCCTCTGCTCCCTACCAGCT
CTCGACTTCGCCACAACATCAAGATAAAAATAACCCACCGAGAGAGGGAAAAAAAAAAAAGCAAAGAAACAAGGC
CCAGAAAAGAGCGCATTTCACCCCTTCACCCTTTCATTCTATCCCGCTCTCGCCCGCCATCGACGACGACGACGA
CGACGACGACGACGACTACCGCAACGATTCCCAGACGTCGAATCTCCGCTGACTCCCGGTCGGAGTCGCCCAGTC
GCCCGTCCTGGCTACCAGGTCAGACAGATTCCGCACCCCTTAGGCTCTCAAGGCCCTCTTCCCGCTCACCTTCTC
AGCAGGACGTCGTCTCTCGATTACAACTCAAAGTACTCGCGCGAATTCGGACAGGCCTACCCGCAGCCCGCATAC
TCGCAGCCCGCCTACGCGGAGAATGCCAATCTGAACGCTGGCTTCGATCAGGGCTACGCCTATCGCCAGGGCCTG
GCCTCTTCCAATCCGGCCAGGAGTGTCTACCGCGACAGGATGAGCTTCCTCAAGTCGAAATGGCCCGCCGCCTTC
ATGGCCGTCGCCAGTCTCCAGGCCATCGTTTGCCTGGCATTTGAGTCGTACGCCACCCGTCGTCACCCCCTTGGA
CGCCCGCTTACCAGCTTGCAACAGATTTGTCTTTGCTTCCTTCCAGTCGAGCCTCGGCCGTTATGACAACAAGCC
CGATGTTCAATCCCAGTACAAGACGATTCCCACCTTTTTGACCCTCATCATCTTTGGCTTCCTGTACGAGCTGGT
CGTCGTCTGGGATGCGCTGCGAATGAAAAACACCATCCAGGTCATTGGCGTCTGCATCGCCAACCTGGCCCTGCT
CGTCTACACCGCCATCCAGGTCGACCAGATCCAGATGGCCATCAGCACCCTCGGTATCGCCGCCTTGAAGCCCGG
CATCACCCCGGACCAGGTCTGGTCTCAGCTGAGGCCCTTCCTCGTCGCCATCCCTGCCATCATCGCCCTCGCCAC
CGCCGCCATGGTCTTCATCGCCTGGAAGCTCTACCAGGAGTTTGCCTGGGACATTCTCAAGAACATTGGCGCCGA
CTATCGCATGAAGAAGCGCTTCCTCCATTATCAGGTTCGCCTCCCATACCCGTTTCGCCGTCACGTCACCGCCAA
CGCAAAAAAGCTCACACCCCTCTTCTCAGATCTACATTGCCCTCCTCAAGTTCGACTTCTTCTTCTTCCTCGGCT
TCATCATCCAATTCGTCGTCATCGTCGCCCAAAAGACCGATCCCGAGTTCGCCCTGACCATCGCCACCATCCCCG
TCACCATCTGCATCCTCCTCGCCGCCGCCTACTTCACTCGCCGCGAGAACAAGCTCGGCATGATGGCCGTCATCA
TCCTCTACCTCGGCGGCCTCATCTACTTCATCTTCAAGCTCGTCCGCATCTACCAGCCCGCCTACAGGCTCTTCT
ACCTGCCCGTCCGCAAGTCCCTAACCGCCTTTGCCGTCATCACCATCCTATTGATCCTCCTCACCATTGCAAACG
CCGTCATCTGCATGGGCAACTTTGACAAGGGGCTCAAGGCTCACCTGCTGACCCCCCGCCGGATGGACGAGAAGC
CGGATGCACACTCCATCAGTCTGCACGACGTCAAGCCGCAGATTCCCAGCCGGATGACCATCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail