Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02333
Gene name
Locationscaffold_02:3366290..3368139
Strand+
Gene length (bp)1849
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 190 212 22
3 225 247 22
4 326 348 22
5 368 390 22
6 400 422 22
7 482 504 22
8 524 546 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 23.30 12.39 34.21
Alive In ants, during behavior modification 28.04 14.95 41.13
Dead In ants, recently dead 34.57 19.27 49.88

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.394853 no
Alive Dead 0.241555 no
Dead Fungus 0.049238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02333
MSFFQFTQGTEAHSRPSDSSPLLGRYRAVPPRRDRRRQVSLGGRGSVHVGYGALMAAAAADDDDDDDDDEDGRGQ
RAERTLLQAWLLDLWVVPRQSAVKRVVDRWWSRYGLLVVLPTALVVGWCAVPLPQYPLDTKPEEPGKTPGHGAAR
VRLNFWFFLLVYYGLYSLTALAWITKVFNLYSLNWWPRSLGFPLTLSLVGALSVAVPVPVYWSARTRFLTEHNTA
WIAWTFVVMALPVAMALAILMTNARHVGGRHELSETQRIFTSSWWRAEPNRGTVPSSSDEAMPAAVPTMTSMSTR
AAAAATATTTTATATATETASAWHPASFVRFLWLCVALSIGLLAYVLGEAYAELYLGTLPHNSLETVVYVYGWVA
TVHLLDALTGWTLGIREGERVGSYPLSWVFKLYFTLTYQTYVRALYARLRSPSQFVVLQLLSSTTLVVLTPLSMT
RRYHGLLVATGLNGQSFGSYQKLQARNVFIRFLAENASMATFLASIAVLHYGANRNVYPYFALDDEAEPYDLALT
LWASSVTWACEMVASLAVRALIRLCFAVDVGVEGRQDLAVWPELLPTCVTVTLHVLQNMMFSIIRLQFYD*
Coding >Ophcf2|02333
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCGCGACCCAGCGACTCATCACCGCTGCTGGGCCGG
TACCGTGCCGTCCCGCCACGACGCGACCGGCGGAGGCAGGTCTCGCTGGGCGGGCGAGGGAGCGTCCACGTCGGA
TACGGGGCTCTGATGGCGGCGGCGGCGGCCGACGACGACGACGACGACGACGACGACGAGGATGGGCGAGGGCAG
CGGGCGGAGCGGACTCTGTTGCAGGCCTGGCTTCTGGATCTGTGGGTGGTCCCGAGGCAGTCTGCGGTGAAGCGG
GTGGTGGACAGGTGGTGGAGTCGGTACGGGCTGCTGGTGGTGCTGCCGACGGCGCTGGTGGTGGGTTGGTGCGCG
GTGCCGCTTCCGCAGTATCCGCTGGACACGAAACCGGAGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGA
GTGCGGCTCAACTTCTGGTTCTTCCTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCACTGGCGTGGATCACA
AAGGTGTTTAACCTGTACAGCCTCAACTGGTGGCCGCGGTCGTTGGGATTCCCGCTCACGCTGTCGCTGGTGGGC
GCGCTGTCGGTCGCGGTGCCGGTGCCGGTATATTGGAGTGCGCGGACGAGGTTCCTGACGGAGCATAACACTGCG
TGGATTGCGTGGACGTTTGTGGTCATGGCCTTGCCGGTCGCCATGGCGCTGGCCATCCTCATGACCAATGCGCGG
CATGTCGGGGGTCGTCATGAGTTGTCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGGGCCGAGCCGAAT
AGGGGGACCGTCCCGTCGTCGTCGGATGAGGCGATGCCGGCAGCCGTACCGACGATGACATCGATGTCGACAAGA
GCAGCAGCAGCAGCAACAGCAACGACAACAACAGCGACAGCAACAGCAACAGAGACAGCATCGGCCTGGCATCCC
GCCAGCTTCGTCCGCTTCCTCTGGCTCTGCGTCGCTCTGTCGATAGGTCTACTGGCGTACGTCCTCGGCGAGGCC
TACGCAGAGCTCTACCTCGGCACCCTACCGCACAACAGCCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCG
ACCGTGCATCTGCTCGACGCGCTGACGGGCTGGACGCTGGGTATTCGTGAGGGCGAACGGGTCGGAAGCTACCCT
CTCAGCTGGGTCTTCAAGCTCTACTTTACACTGACGTATCAGACGTACGTGCGCGCTCTATACGCCCGTCTGCGG
TCGCCGTCGCAGTTTGTTGTCCTGCAGCTGCTCTCTTCCACGACGTTGGTGGTGCTCACGCCCCTTTCCATGACG
CGGCGTTATCATGGTCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTCGGCTCGTATCAGAAGCTGCAGGCT
CGCAACGTCTTCATCCGCTTCCTGGCGGAGAATGCGTCGATGGCGACCTTCTTAGCCAGCATCGCCGTCTTGCAC
TACGGCGCCAACCGCAATGTGTATCCTTACTTTGCGCTGGACGACGAGGCAGAGCCGTACGATCTGGCCTTGACG
CTATGGGCATCGTCTGTTACCTGGGCTTGTGAAATGGTGGCCAGCCTTGCCGTTCGCGCCCTGATACGACTATGT
TTCGCCGTGGATGTCGGGGTCGAGGGGAGGCAGGACCTTGCGGTATGGCCCGAGTTGCTGCCCACGTGCGTGACA
GTAACGCTGCACGTGTTGCAGAACATGATGTTTTCCATCATCCGGCTGCAGTTTTACGACTAA
Transcript >Ophcf2|02333
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCGCGACCCAGCGACTCATCACCGCTGCTGGGCCGG
TACCGTGCCGTCCCGCCACGACGCGACCGGCGGAGGCAGGTCTCGCTGGGCGGGCGAGGGAGCGTCCACGTCGGA
TACGGGGCTCTGATGGCGGCGGCGGCGGCCGACGACGACGACGACGACGACGACGACGAGGATGGGCGAGGGCAG
CGGGCGGAGCGGACTCTGTTGCAGGCCTGGCTTCTGGATCTGTGGGTGGTCCCGAGGCAGTCTGCGGTGAAGCGG
GTGGTGGACAGGTGGTGGAGTCGGTACGGGCTGCTGGTGGTGCTGCCGACGGCGCTGGTGGTGGGTTGGTGCGCG
GTGCCGCTTCCGCAGTATCCGCTGGACACGAAACCGGAGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGA
GTGCGGCTCAACTTCTGGTTCTTCCTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCACTGGCGTGGATCACA
AAGGTGTTTAACCTGTACAGCCTCAACTGGTGGCCGCGGTCGTTGGGATTCCCGCTCACGCTGTCGCTGGTGGGC
GCGCTGTCGGTCGCGGTGCCGGTGCCGGTATATTGGAGTGCGCGGACGAGGTTCCTGACGGAGCATAACACTGCG
TGGATTGCGTGGACGTTTGTGGTCATGGCCTTGCCGGTCGCCATGGCGCTGGCCATCCTCATGACCAATGCGCGG
CATGTCGGGGGTCGTCATGAGTTGTCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGGGCCGAGCCGAAT
AGGGGGACCGTCCCGTCGTCGTCGGATGAGGCGATGCCGGCAGCCGTACCGACGATGACATCGATGTCGACAAGA
GCAGCAGCAGCAGCAACAGCAACGACAACAACAGCGACAGCAACAGCAACAGAGACAGCATCGGCCTGGCATCCC
GCCAGCTTCGTCCGCTTCCTCTGGCTCTGCGTCGCTCTGTCGATAGGTCTACTGGCGTACGTCCTCGGCGAGGCC
TACGCAGAGCTCTACCTCGGCACCCTACCGCACAACAGCCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCG
ACCGTGCATCTGCTCGACGCGCTGACGGGCTGGACGCTGGGTATTCGTGAGGGCGAACGGGTCGGAAGCTACCCT
CTCAGCTGGGTCTTCAAGCTCTACTTTACACTGACGTATCAGACGTACGTGCGCGCTCTATACGCCCGTCTGCGG
TCGCCGTCGCAGTTTGTTGTCCTGCAGCTGCTCTCTTCCACGACGTTGGTGGTGCTCACGCCCCTTTCCATGACG
CGGCGTTATCATGGTCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTCGGCTCGTATCAGAAGCTGCAGGCT
CGCAACGTCTTCATCCGCTTCCTGGCGGAGAATGCGTCGATGGCGACCTTCTTAGCCAGCATCGCCGTCTTGCAC
TACGGCGCCAACCGCAATGTGTATCCTTACTTTGCGCTGGACGACGAGGCAGAGCCGTACGATCTGGCCTTGACG
CTATGGGCATCGTCTGTTACCTGGGCTTGTGAAATGGTGGCCAGCCTTGCCGTTCGCGCCCTGATACGACTATGT
TTCGCCGTGGATGTCGGGGTCGAGGGGAGGCAGGACCTTGCGGTATGGCCCGAGTTGCTGCCCACGTGCGTGACA
GTAACGCTGCACGTGTTGCAGAACATGATGTTTTCCATCATCCGGCTGCAGTTTTACGACTAA
Gene >Ophcf2|02333
ATGTCCTTCTTCCAGTTCACGCAGGGCACCGAGGCGCACTCGCGACCCAGCGACTCATCACCGCTGCTGGGCCGG
TACCGTGCCGTCCCGCCACGACGCGACCGGCGGAGGCAGGTCTCGCTGGGCGGGCGAGGGAGCGTCCACGTCGGA
TACGGGGCTCTGATGGCGGCGGCGGCGGCCGACGACGACGACGACGACGACGACGACGAGGATGGGCGAGGGCAG
CGGGCGGAGCGGACTCTGTTGCAGGCCTGGCTTCTGGATCTGTGGGTGGTCCCGAGGCAGTCTGCGGTGAAGCGG
GTGGTGGACAGGTGGTGGAGTCGGTACGGGCTGCTGGTGGTGCTGCCGACGGCGCTGGTGAGGCTATCCAGGAAC
CCAAGGCGTTATCGATGGCCCGAACTGACGTGAGGTTGGCAAGGTGGTGGGTTGGTGCGCGGTGCCGCTTCCGCA
GTATCCGCTGGACACGAAACCGGAGGAGCCGGGCAAGACGCCGGGCCACGGGGCGGCACGAGTGCGGCTCAACTT
CTGGTTCTTCCTGCTGGTGTACTACGGGCTGTACAGCCTGACGGCACTGGCGTGGATCACAAAGGTGTTTAACCT
GTACAGCCTCAACTGGTGGCCGCGGTCGTTGGGATTCCCGCTCACGCTGTCGCTGGTGGGCGCGCTGTCGGTCGC
GGTGCCGGTGCCGGTATATTGGAGTGCGCGGACGAGGTTCCTGACGGAGCATAACACTGCGTGGATTGCGTGGAC
GTTTGTGGTCATGGCCTTGCCGGTCGCCATGGCGCTGGCCATCCTCATGACCAATGCGCGGCATGTCGGGGGTCG
TCATGAGTTGTCGGAGACGCAGCGCATCTTTACGTCTTCGTGGTGGAGGGCCGAGCCGAATAGGGGGACCGTCCC
GTCGTCGTCGGATGAGGCGATGCCGGCAGCCGTACCGACGATGACATCGATGTCGACAAGAGCAGCAGCAGCAGC
AACAGCAACGACAACAACAGCGACAGCAACAGCAACAGAGACAGCATCGGCCTGGCATCCCGCCAGCTTCGTCCG
CTTCCTCTGGCTCTGCGTCGCTCTGTCGATAGGTCTACTGGCGTACGTCCTCGGCGAGGCCTACGCAGAGCTCTA
CCTCGGCACCCTACCGCACAACAGCCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCGACCGTGCATCTGCT
CGACGCGCTGACGGGCTGGACGCTGGGTATTCGTGAGGGCGAACGGGTCGGAAGCTACCCTCTCAGCTGGGTCTT
CAAGCTCTACTTTACACTGACGTATCAGACGTACGTGCGCGCTCTATACGCCCGTCTGCGGTCGCCGTCGCAGTT
TGTTGTCCTGCAGCTGCTCTCTTCCACGACGTTGGTGGTGCTCACGCCCCTTTCCATGACGCGGCGTTATCATGG
TCTGCTGGTGGCTACGGGCCTCAACGGGCAGAGCTTCGGCTCGTATCAGAAGCTGCAGGCTCGCAACGTCTTCAT
CCGCTTCCTGGCGGAGAATGCGTCGATGGCGACCTTCTTAGCCAGCATCGCCGTCTTGCACTACGGCGCCAACCG
CAATGTGTATCCTTACTTTGCGCTGGACGACGAGGCAGAGCCGTACGATCTGGCCTTGACGCTATGGGCATCGTC
TGTTACCTGGGCTTGTGAAATGGTGGCCAGCCTTGCCGTTCGCGCCCTGATACGACTATGTTTCGCCGTGGATGT
CGGGGTCGAGGGGAGGCAGGACCTTGCGGTATGGCCCGAGTTGCTGCCCACGTGCGTGACAGTAACGCTGCACGT
GTTGCAGAACATGATGTTTTCCATCATCCGGCTGCAGTTTTACGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail