Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02329
Gene name
Locationscaffold_02:3358448..3360464
Strand+
Gene length (bp)2016
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.1E-08 341 385

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 226 248 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 52.41 29.93 74.89
Alive In ants, during behavior modification 86.80 47.90 125.69
Dead In ants, recently dead 79.69 45.28 114.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.003907 yes
Alive Dead 0.657163 no
Dead Fungus 0.021081 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02329
MSLIEIQNAVLLVSNPVWEGDKTVPSTIVRNISALSSQIGYEDRISTNLTTLATTNAPKLDGTFGGLLFVPQVTA
VPDCDAQQYDFLPRNVTRREQLPPSNLNVVAIAPWFSIECTRAYLSSAARGSARALIFYKPNNSSNKPQDVDSPV
WSLDDDDDWRKNYHFPIFAIPGLEGQKMVLQLSLYSGSIDQVPHGQEISQLYGPNPSDYVRVWTELTMQNTSNVP
AVWAFVLIVIAALLFVIAVVSLAMHFIQRRNRSSLQRRVQSGEVDLEAMGIKRLTVPASHVDRFPLFTYNAEAEL
ANAPRSPSAGPRSVRSLRSIRSKRSSIAGTTDTTATNFQPNCHICLAGFEHCKTVIRELPCGHIFHPACIDEFLT
QNSSLCPMCKHCMLPRGYSPKITNGMVRREQAVRRLREHVDFEDSSVDSGELKLREWGKRFFAKSDAPVDPGAAT
AGDASSASATPAPDAPPQPRPPPSRKAEARRTRPRALRLLPTHHEGVEPKEDETAVGRLSPSSFARERMRQIAES
NAPFDDDLDSRRPKWRRALSKAFPGFS*
Coding >Ophcf2|02329
ATGTCGCTCATCGAGATTCAAAATGCCGTACTCTTGGTCAGCAACCCGGTTTGGGAGGGCGACAAGACGGTCCCC
TCGACAATCGTCAGGAACATCTCGGCCCTGTCTAGCCAGATAGGCTACGAGGATCGCATATCTACCAACCTCACC
ACTCTCGCCACCACAAACGCCCCCAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGGTCACCGCT
GTCCCCGACTGCGACGCCCAGCAGTACGACTTCCTCCCCCGCAATGTCACCCGCCGCGAGCAGCTTCCCCCCAGC
AACCTCAACGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGCGCCTACCTCTCCTCCGCCGCCCGC
GGCTCCGCCCGCGCCCTCATCTTCTACAAACCCAACAACTCGTCCAACAAGCCCCAGGACGTTGACTCGCCAGTC
TGGAGCCTCGACGATGACGACGACTGGCGCAAGAACTACCACTTTCCCATCTTCGCCATCCCGGGCCTCGAGGGC
CAAAAGATGGTACTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATTAGCCAG
CTCTACGGGCCCAACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCC
GCCGTTTGGGCCTTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCAT
TTCATCCAGCGCCGGAATCGATCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGC
ATCAAACGCCTGACCGTCCCGGCCTCACACGTCGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTG
GCCAACGCCCCGCGCTCCCCTTCGGCCGGCCCTCGGAGCGTCCGCAGTCTGCGCAGCATCCGCAGCAAGAGGTCG
AGCATCGCGGGCACCACCGACACCACCGCCACCAACTTCCAGCCCAACTGCCACATCTGCCTCGCCGGCTTCGAG
CACTGCAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACG
CAAAACAGCTCACTGTGTCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATTACAAACGGC
ATGGTCCGTCGTGAGCAGGCCGTGCGCCGACTGAGGGAGCACGTCGACTTTGAGGACTCGTCGGTCGACTCGGGC
GAGCTTAAGCTCAGGGAATGGGGTAAGCGCTTCTTCGCCAAATCGGACGCCCCCGTCGATCCGGGCGCCGCCACG
GCCGGAGACGCTTCCTCGGCTTCGGCCACGCCCGCCCCGGACGCGCCCCCTCAACCCCGGCCGCCCCCGTCCCGG
AAAGCGGAGGCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCGACGCACCACGAGGGGGTCGAGCCGAAG
GAGGACGAGACGGCCGTCGGGCGCCTGAGCCCTTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGC
AACGCGCCCTTTGACGACGACCTGGATAGTCGGCGTCCGAAGTGGCGACGAGCGCTATCCAAGGCCTTTCCCGGC
TTTTCGTAG
Transcript >Ophcf2|02329
ATGTCGCTCATCGAGATTCAAAATGCCGTACTCTTGGTCAGCAACCCGGTTTGGGAGGGCGACAAGACGGTCCCC
TCGACAATCGTCAGGAACATCTCGGCCCTGTCTAGCCAGATAGGCTACGAGGATCGCATATCTACCAACCTCACC
ACTCTCGCCACCACAAACGCCCCCAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGGTCACCGCT
GTCCCCGACTGCGACGCCCAGCAGTACGACTTCCTCCCCCGCAATGTCACCCGCCGCGAGCAGCTTCCCCCCAGC
AACCTCAACGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGCGCCTACCTCTCCTCCGCCGCCCGC
GGCTCCGCCCGCGCCCTCATCTTCTACAAACCCAACAACTCGTCCAACAAGCCCCAGGACGTTGACTCGCCAGTC
TGGAGCCTCGACGATGACGACGACTGGCGCAAGAACTACCACTTTCCCATCTTCGCCATCCCGGGCCTCGAGGGC
CAAAAGATGGTACTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATTAGCCAG
CTCTACGGGCCCAACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCC
GCCGTTTGGGCCTTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCAT
TTCATCCAGCGCCGGAATCGATCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGC
ATCAAACGCCTGACCGTCCCGGCCTCACACGTCGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTG
GCCAACGCCCCGCGCTCCCCTTCGGCCGGCCCTCGGAGCGTCCGCAGTCTGCGCAGCATCCGCAGCAAGAGGTCG
AGCATCGCGGGCACCACCGACACCACCGCCACCAACTTCCAGCCCAACTGCCACATCTGCCTCGCCGGCTTCGAG
CACTGCAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACG
CAAAACAGCTCACTGTGTCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATTACAAACGGC
ATGGTCCGTCGTGAGCAGGCCGTGCGCCGACTGAGGGAGCACGTCGACTTTGAGGACTCGTCGGTCGACTCGGGC
GAGCTTAAGCTCAGGGAATGGGGTAAGCGCTTCTTCGCCAAATCGGACGCCCCCGTCGATCCGGGCGCCGCCACG
GCCGGAGACGCTTCCTCGGCTTCGGCCACGCCCGCCCCGGACGCGCCCCCTCAACCCCGGCCGCCCCCGTCCCGG
AAAGCGGAGGCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCGACGCACCACGAGGGGGTCGAGCCGAAG
GAGGACGAGACGGCCGTCGGGCGCCTGAGCCCTTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGC
AACGCGCCCTTTGACGACGACCTGGATAGTCGGCGTCCGAAGTGGCGACGAGCGCTATCCAAGGCCTTTCCCGGC
TTTTCGTAG
Gene >Ophcf2|02329
ATGTGTGAGTTGTCTGCTCTTCTTGGCTTTTCCCACCGCCAAGATGCATCGCCCAGCACTGACCGGCATGACCAG
CGCTCATCGAGATTCAAAATGCCGTGTGCGTCGAGAGCCCCCTTCGCCTCGCCCGAGCCCGCGCCGCCCGCTGAC
AACTCAGAAGACTCTTGGTCAGCAACCCGGTTTGGGAGGGCGACAAGACGGTCCCCTCGACAATCGTCAGGAACA
TCTCGGCCCTGTCTGTACGTCTAAAACACCACCACCACCACCTCTCCCTCCTCCTCCTCCTTCCTTCTCCTCCAG
AGATGCCCCCTCCTGACGACGGCCAAGAGCCAGATAGGCTACGAGGATCGCATATCTACCAACCTCACCACTCTC
GCCACCACAAACGCCCCCAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTCCCCCAGGTCACCGCTGTCCCC
GACTGCGACGCCCAGCAGTACGACTTCCTCCCCCGCAATGTCACCCGCCGCGAGCAGCTTCCCCCCAGCAACCTC
AACGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGCGCCTACCTCTCCTCCGCCGCCCGCGGCTCC
GCCCGCGCCCTCATCTTCTACAAACCCAACAACTCGTCCAACAAGCCCCAGGACGTTGACTCGCCAGTCTGGAGC
CTCGACGATGACGACGACTGGCGCAAGAACTACCACTTTCCCATCTTCGCCATCCCGGGCCTCGAGGGCCAAAAG
ATGGTACTGCAGCTGAGCCTCTACTCGGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATTAGCCAGCTCTAC
GGGCCCAACCCCAGCGACTACGTCCGCGTCTGGACCGAACTGACGATGCAGAATACGTCCAACGTCCCCGCCGTT
TGGGCCTTTGTCCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCGCCATGCATTTCATC
CAGCGCCGGAATCGATCCTCCCTCCAGCGCCGCGTTCAGTCGGGCGAGGTCGACCTCGAGGCCATGGGCATCAAA
CGCCTGACCGTCCCGGCCTCACACGTCGACCGCTTCCCGCTCTTCACCTACAACGCCGAGGCCGAGCTGGCCAAC
GCCCCGCGCTCCCCGTCGACGCCCACCCCCGGAGGCCCTCGCGTAAGGGCCGGCGTCCCGAGACGCGCTCCGCCC
CGGCCGACGTCGCCAGTTCGGCCGGCCCTCGGAGCGTCCGCAGTCTGCGCAGCATCCGCAGCAAGAGGTCGAGCA
TCGCGGGCACCACCGACACCACCGCCACCAACTTCCAGCCCAACTGCCACATCTGCCTCGCCGGCTTCGAGCACT
GCAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTCCACCCGGCCTGCATCGACGAGTTCCTGACGCAAA
ACAGCTCACTGTGTCCCATGTGCAAGCACTGCATGCTGCCCCGCGGCTACAGCCCCAAGATTACAAACGGCATGG
TCCGTCGTGAGCAGGCCGTGCGCCGACTGAGGGAGCACGTCGACTTTGAGGACTCGTCGGTCGACTCGGGCGAGC
TTAAGCTCAGGGAATGGGGTAAGCGCTTCTTCGCCAAATCGGACGCCCCCGTCGATCCGGGCGCCGCCACGGCCG
GAGACGCTTCCTCGGCTTCGGCCACGCCCGCCCCGGACGCGCCCCCTCAACCCCGGCCGCCCCCGTCCCGGAAAG
CGGAGGCGCGGAGGACGCGGCCCCGGGCCCTCAGGCTGCTACCGACGCACCACGAGGGGGTCGAGCCGAAGGAGG
ACGAGACGGCCGTCGGGCGCCTGAGCCCTTCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGAGAGCAACG
CGCCCTTTGACGACGACCTGGATAGTCGGCGTCCGAAGTGTGAGTTTCCCCCTCCCTCTTTACCCGGTCGCTCCA
AGGTCCGCTGCTGACACCTTTCCAGGGCGACGAGCGCTATCCAAGGCCTTTCCCGGCTTTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail