Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02328
Gene name
Locationscaffold_02:3354021..3357185
Strand+
Gene length (bp)3164
Transcript length (bp)2946
Coding sequence length (bp)2946
Protein length (aa) 982

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07217 Het-C Heterokaryon incompatibility protein Het-C 7.3E-239 12 569

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 137.18 67.41 206.94
Alive In ants, during behavior modification 81.14 40.02 122.25
Dead In ants, recently dead 63.18 34.20 92.15

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.014786 yes
Alive Dead 0.186187 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02328
MPKLSSSGPLLGLVVLVALIGPAAAFGAGNIASISKLEGQNWRHGDIEDALLTLAMAQAMKGKKFTKIMVARVYF
GNWLRDYSQAIDVGTVKSVSAEAIRLLLCVLGFLTFGYGSGEFEVTADRVGCYRPEDHIDNPKNYADNQDARQYD
RRLRGPIDETRELSIDHNTGMKNYIANESAGIMTSAEHVRRLFGGCIELGRRYKNQGNKADLYESLRLMGTGLHC
LEDFFAHSNYTELALIEMGETQVFPHCGRDTLIQLHGARHPVYPIVTGTFGGVDFLHSVVGEVSDKLTQNEIDEL
EGTLQESKNSDTSILRDLLDKIPDGLFGGKKQTEKIDEIQSNASAAQMQGMSVSPRQPEEFTAYVTEVYGQVMPA
IEFHDDIMKAITGAVEKIPVLPKVIEQLEEQLSKFVFSIMAPFVVPLIQQIKNELRTGSDEIVQSSQQEQHIVFE
DDRCSDPTHSMLSKDHFSNILNEIAGRTAAKMLHWVVPQLMEAIDDDGVDVNRLLNRIIYGVMHHPAQREMGNDG
VAEARQLIYGCVQEWWGEMDDAQRDDYRRKLTREGVQNGDNHKEGVDDTGHGHGCVGKLKMRKLYGQQDTLENRI
AGAAADAIFQTATGAISGVVEQNTGMKLPSTQGSQQAEEPKEEGGFGGFIGSLLGGAFGGKDTETRGSQRREDDG
SVTQTQTEFGRQGHHYGQAEYSQTQRPDGSSESHYSRFEQRESHGGRQTSGYGYEERTETRPMHGGGYEQRTERQ
EYRGSGQGGGGYGRESQGGYGGGGEYGRESQNQSYGRESQQGGGYGQGGGYGRESQGDGYGRERRSDSYGRDSGY
GRASQSDSYGRESYERESQRSGHGRESYEREGQRGGYGGESHERESQHSGYGRESQSSGYGQDSGYGRESQSEAY
GQSGGYGRQTEDYDNRGYGGSKGRRGNDDDDDDDDDDDEDYDNRRGHGRRRDDNNYGDEGRRGGRRGDDYYSSSS
SNSRGY*
Coding >Ophcf2|02328
ATGCCTAAACTCAGTAGCAGCGGTCCACTCTTGGGCCTCGTCGTTCTCGTTGCCCTGATCGGTCCGGCCGCCGCC
TTTGGAGCTGGCAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGGCGACATGGCGACATCGAGGACGCT
CTCCTCACCCTGGCCATGGCTCAGGCCATGAAGGGCAAGAAGTTCACGAAAATCATGGTCGCCCGCGTGTACTTT
GGAAACTGGTTGCGCGACTATTCACAGGCCATCGACGTCGGTACCGTCAAGTCCGTCTCGGCCGAGGCCATCCGC
CTTCTTCTCTGCGTCCTCGGCTTCCTCACCTTTGGCTACGGCTCCGGCGAGTTCGAGGTGACGGCCGATCGAGTT
GGATGCTACCGCCCGGAGGATCACATCGACAACCCCAAGAACTATGCCGACAACCAAGATGCACGACAGTACGAC
CGCCGCCTTCGTGGTCCCATTGATGAGACGAGGGAGCTGTCCATCGACCACAATACAGGCATGAAGAACTACATC
GCCAACGAGAGCGCCGGCATCATGACATCGGCCGAACATGTCAGGAGGCTCTTTGGAGGCTGCATCGAGCTCGGC
CGCCGCTACAAGAACCAAGGCAACAAGGCCGACCTCTACGAGTCGCTTCGCCTCATGGGTACCGGCCTACACTGC
CTCGAAGACTTTTTCGCCCACAGCAACTACACGGAGCTGGCTCTGATCGAGATGGGCGAGACCCAAGTCTTTCCT
CACTGCGGACGAGATACCCTCATCCAGCTTCATGGCGCCCGCCATCCTGTCTACCCCATCGTCACAGGTACCTTT
GGTGGCGTCGATTTCCTCCACTCCGTCGTGGGCGAAGTCTCGGACAAATTGACGCAGAACGAAATTGACGAGCTC
GAGGGCACGTTGCAGGAGAGCAAGAACTCGGACACCAGCATACTGCGAGATCTTCTCGACAAGATCCCCGACGGC
CTCTTTGGCGGCAAGAAGCAGACGGAAAAGATTGATGAGATCCAGTCCAACGCGTCTGCGGCTCAGATGCAGGGC
ATGTCCGTCTCGCCGCGGCAGCCCGAAGAGTTCACGGCGTACGTGACCGAAGTCTACGGCCAGGTGATGCCGGCC
ATCGAATTCCACGACGACATCATGAAGGCCATCACGGGCGCCGTCGAGAAGATCCCCGTGCTGCCAAAGGTCATC
GAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTTTCCATCATGGCTCCATTTGTCGTTCCCCTGATCCAGCAG
ATCAAGAACGAACTCCGGACCGGATCCGACGAGATTGTCCAGAGCAGCCAGCAGGAGCAACACATCGTCTTCGAG
GACGATCGCTGCAGCGACCCGACGCACTCGATGCTCTCCAAGGATCACTTCTCCAATATCCTGAACGAGATCGCG
GGCCGGACGGCGGCCAAGATGCTACACTGGGTCGTGCCCCAGCTCATGGAGGCCATCGACGACGACGGCGTAGAC
GTGAACCGCCTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCCCAGCGAGAGATGGGCAACGACGGC
GTGGCCGAGGCTCGGCAGCTCATCTACGGATGCGTGCAGGAGTGGTGGGGCGAGATGGACGACGCGCAGAGAGAC
GACTATCGGCGAAAGCTCACGCGCGAGGGCGTCCAGAACGGAGACAACCACAAGGAGGGCGTCGACGACACGGGC
CACGGACACGGCTGCGTGGGCAAGCTCAAGATGCGTAAGCTGTATGGGCAGCAGGACACGCTCGAGAACAGAATC
GCGGGCGCGGCGGCCGACGCCATCTTCCAGACGGCCACGGGGGCAATCTCGGGCGTGGTGGAGCAGAACACGGGC
ATGAAGCTGCCGTCGACTCAGGGCTCGCAACAGGCAGAGGAGCCCAAGGAGGAGGGCGGCTTCGGCGGCTTCATC
GGCTCTCTCCTCGGCGGCGCCTTTGGTGGGAAGGACACCGAGACGCGCGGCAGCCAGCGGCGGGAGGACGACGGC
TCGGTGACGCAGACGCAGACGGAGTTCGGCCGGCAGGGTCACCACTACGGCCAGGCCGAGTACAGCCAGACGCAG
CGGCCGGACGGCAGCAGCGAGTCGCATTACAGCCGGTTCGAGCAGCGGGAGTCGCACGGCGGGCGGCAGACGTCT
GGCTACGGCTACGAGGAGAGGACGGAGACGCGGCCGATGCACGGGGGCGGGTACGAGCAGCGGACCGAGCGGCAG
GAGTACAGAGGCTCCGGCCAGGGCGGCGGCGGCTACGGACGCGAGAGCCAGGGCGGCTACGGTGGCGGCGGCGAA
TACGGACGCGAGAGCCAGAACCAGAGCTATGGCCGCGAGAGCCAGCAGGGCGGCGGCTACGGTCAGGGCGGCGGC
TACGGTCGCGAGAGCCAGGGTGACGGCTACGGGCGCGAGAGGCGAAGTGACAGCTACGGCCGCGATAGTGGATAT
GGCCGCGCCAGCCAGAGCGACAGCTACGGACGCGAGAGCTACGAGCGAGAGAGCCAGCGCAGCGGCCATGGTCGA
GAGAGCTACGAGCGGGAAGGCCAGCGGGGTGGCTACGGTGGAGAGAGCCACGAGCGGGAGAGCCAGCACAGCGGC
TACGGCCGAGAGAGCCAGAGCAGCGGCTACGGTCAAGACAGCGGCTACGGGCGGGAGAGTCAGAGCGAGGCGTAC
GGTCAGAGCGGTGGCTACGGCCGGCAGACGGAAGATTACGACAATAGAGGGTACGGGGGAAGCAAGGGTAGACGC
GGAAATGACGACGACGACGACGACGACGACGACGACGACGAGGACTACGATAACAGACGTGGTCACGGAAGACGA
CGAGACGACAACAACTATGGGGACGAAGGCAGACGCGGCGGGCGGCGGGGAGACGACTACTACTCGTCGTCGTCG
TCCAACTCGCGGGGATACTAG
Transcript >Ophcf2|02328
ATGCCTAAACTCAGTAGCAGCGGTCCACTCTTGGGCCTCGTCGTTCTCGTTGCCCTGATCGGTCCGGCCGCCGCC
TTTGGAGCTGGCAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGGCGACATGGCGACATCGAGGACGCT
CTCCTCACCCTGGCCATGGCTCAGGCCATGAAGGGCAAGAAGTTCACGAAAATCATGGTCGCCCGCGTGTACTTT
GGAAACTGGTTGCGCGACTATTCACAGGCCATCGACGTCGGTACCGTCAAGTCCGTCTCGGCCGAGGCCATCCGC
CTTCTTCTCTGCGTCCTCGGCTTCCTCACCTTTGGCTACGGCTCCGGCGAGTTCGAGGTGACGGCCGATCGAGTT
GGATGCTACCGCCCGGAGGATCACATCGACAACCCCAAGAACTATGCCGACAACCAAGATGCACGACAGTACGAC
CGCCGCCTTCGTGGTCCCATTGATGAGACGAGGGAGCTGTCCATCGACCACAATACAGGCATGAAGAACTACATC
GCCAACGAGAGCGCCGGCATCATGACATCGGCCGAACATGTCAGGAGGCTCTTTGGAGGCTGCATCGAGCTCGGC
CGCCGCTACAAGAACCAAGGCAACAAGGCCGACCTCTACGAGTCGCTTCGCCTCATGGGTACCGGCCTACACTGC
CTCGAAGACTTTTTCGCCCACAGCAACTACACGGAGCTGGCTCTGATCGAGATGGGCGAGACCCAAGTCTTTCCT
CACTGCGGACGAGATACCCTCATCCAGCTTCATGGCGCCCGCCATCCTGTCTACCCCATCGTCACAGGTACCTTT
GGTGGCGTCGATTTCCTCCACTCCGTCGTGGGCGAAGTCTCGGACAAATTGACGCAGAACGAAATTGACGAGCTC
GAGGGCACGTTGCAGGAGAGCAAGAACTCGGACACCAGCATACTGCGAGATCTTCTCGACAAGATCCCCGACGGC
CTCTTTGGCGGCAAGAAGCAGACGGAAAAGATTGATGAGATCCAGTCCAACGCGTCTGCGGCTCAGATGCAGGGC
ATGTCCGTCTCGCCGCGGCAGCCCGAAGAGTTCACGGCGTACGTGACCGAAGTCTACGGCCAGGTGATGCCGGCC
ATCGAATTCCACGACGACATCATGAAGGCCATCACGGGCGCCGTCGAGAAGATCCCCGTGCTGCCAAAGGTCATC
GAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTTTCCATCATGGCTCCATTTGTCGTTCCCCTGATCCAGCAG
ATCAAGAACGAACTCCGGACCGGATCCGACGAGATTGTCCAGAGCAGCCAGCAGGAGCAACACATCGTCTTCGAG
GACGATCGCTGCAGCGACCCGACGCACTCGATGCTCTCCAAGGATCACTTCTCCAATATCCTGAACGAGATCGCG
GGCCGGACGGCGGCCAAGATGCTACACTGGGTCGTGCCCCAGCTCATGGAGGCCATCGACGACGACGGCGTAGAC
GTGAACCGCCTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCCCAGCGAGAGATGGGCAACGACGGC
GTGGCCGAGGCTCGGCAGCTCATCTACGGATGCGTGCAGGAGTGGTGGGGCGAGATGGACGACGCGCAGAGAGAC
GACTATCGGCGAAAGCTCACGCGCGAGGGCGTCCAGAACGGAGACAACCACAAGGAGGGCGTCGACGACACGGGC
CACGGACACGGCTGCGTGGGCAAGCTCAAGATGCGTAAGCTGTATGGGCAGCAGGACACGCTCGAGAACAGAATC
GCGGGCGCGGCGGCCGACGCCATCTTCCAGACGGCCACGGGGGCAATCTCGGGCGTGGTGGAGCAGAACACGGGC
ATGAAGCTGCCGTCGACTCAGGGCTCGCAACAGGCAGAGGAGCCCAAGGAGGAGGGCGGCTTCGGCGGCTTCATC
GGCTCTCTCCTCGGCGGCGCCTTTGGTGGGAAGGACACCGAGACGCGCGGCAGCCAGCGGCGGGAGGACGACGGC
TCGGTGACGCAGACGCAGACGGAGTTCGGCCGGCAGGGTCACCACTACGGCCAGGCCGAGTACAGCCAGACGCAG
CGGCCGGACGGCAGCAGCGAGTCGCATTACAGCCGGTTCGAGCAGCGGGAGTCGCACGGCGGGCGGCAGACGTCT
GGCTACGGCTACGAGGAGAGGACGGAGACGCGGCCGATGCACGGGGGCGGGTACGAGCAGCGGACCGAGCGGCAG
GAGTACAGAGGCTCCGGCCAGGGCGGCGGCGGCTACGGACGCGAGAGCCAGGGCGGCTACGGTGGCGGCGGCGAA
TACGGACGCGAGAGCCAGAACCAGAGCTATGGCCGCGAGAGCCAGCAGGGCGGCGGCTACGGTCAGGGCGGCGGC
TACGGTCGCGAGAGCCAGGGTGACGGCTACGGGCGCGAGAGGCGAAGTGACAGCTACGGCCGCGATAGTGGATAT
GGCCGCGCCAGCCAGAGCGACAGCTACGGACGCGAGAGCTACGAGCGAGAGAGCCAGCGCAGCGGCCATGGTCGA
GAGAGCTACGAGCGGGAAGGCCAGCGGGGTGGCTACGGTGGAGAGAGCCACGAGCGGGAGAGCCAGCACAGCGGC
TACGGCCGAGAGAGCCAGAGCAGCGGCTACGGTCAAGACAGCGGCTACGGGCGGGAGAGTCAGAGCGAGGCGTAC
GGTCAGAGCGGTGGCTACGGCCGGCAGACGGAAGATTACGACAATAGAGGGTACGGGGGAAGCAAGGGTAGACGC
GGAAATGACGACGACGACGACGACGACGACGACGACGACGAGGACTACGATAACAGACGTGGTCACGGAAGACGA
CGAGACGACAACAACTATGGGGACGAAGGCAGACGCGGCGGGCGGCGGGGAGACGACTACTACTCGTCGTCGTCG
TCCAACTCGCGGGGATACTAG
Gene >Ophcf2|02328
ATGCCTAAACTCAGTAGCAGCGGTCCACTCTTGGGCCTCGTCGTTCTCGTTGCCCTGATCGGTCCGGCCGCCGCC
TTTGGAGCTGGCAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGTAGGTGCTCCGTCTGTCTTATCGTC
TGAGCCGGCTGACTTTTCCGCTTCGCAGGGCGACATGGCGACATCGAGGACGCTCTCCTCACCCTGGCCATGGCT
CAGGCCATGAAGGGCAAGAAGTTCACGAAAATCATGGTCGCCCGCGTGTACTTTGGAAACTGGTTGCGCGACTAT
TCACAGGCCATCGACGTCGGTACCGTCAAGTCCGTCTCGGCCGAGGCCATCCGCCTTCTTCTCTGCGTCCTCGGC
TTCCTCACCTTTGGCTACGGCTCCGGCGAGTTCGAGGTGACGGCCGATCGAGTTGGATGCTACCGCCCGGAGGAT
CACATCGACAACCCCAAGAACTATGCCGACAACCAAGATGCACGACAGTACGACCGCCGCCTTCGTGGTCCCATT
GATGAGACGAGGGAGCTGTCCATCGACCACAATACAGGCATGAAGAACTACATCGCCAACGAGAGCGCCGGCATC
ATGACATCGGCCGAACATGTCAGGAGGCTCTTTGGAGGCTGCATCGAGCTCGGCCGCCGCTACAAGAACCAAGGC
AACAAGGCCGACCTCTACGAGTCGCTTCGCCTCATGGGTACCGGCCTACACTGCCTCGAAGGTGCGTGTAGCCTT
GGGTTTGACATGTTCCTGCGCTGACTGTCGTTCTGCAGACTTTTTCGCCCACAGCAACTACACGGAGCTGGCTCT
GATCGAGATGGGCGAGACCCAAGTCTTTCCTCACTGCGGACGAGATACCCTCATCCAGCTTCATGGCGCCCGCCA
TCCTGTCTACCCCATCGTCACAGGTACCTTTGGTGGCGTCGATTTCCTCCACTCCGTCGTGGGCGAAGGTCGGGC
ATTTCATCCCCAGCCTCGGTGTCGTCACAGCTGACAGATGTCGCAGTCTCGGACAAATTGACGCAGAACGAAATT
GACGAGCTCGAGGGCACGTTGCAGGAGAGCAAGAACTCGGACACCAGCATACTGCGAGATCTTCTCGACAAGATC
CCCGACGGCCTCTTTGGCGGCAAGAAGCAGACGGAAAAGATTGATGAGATCCAGTCCAACGCGTCTGCGGCTCAG
ATGCAGGGCATGTCCGTCTCGCCGCGGCAGCCCGAAGAGTTCACGGCGTACGTGACCGAAGTCTACGGCCAGGTG
ATGCCGGCCATCGAATTCCACGACGACATCATGAAGGCCATCACGGGCGCCGTCGAGAAGATCCCCGTGCTGCCA
AAGGTCATCGAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTTTCCATCATGGCTCCATTTGTCGTTCCCCTG
ATCCAGCAGATCAAGAACGAACTCCGGACCGGATCCGACGAGATTGTCCAGAGCAGCCAGCAGGAGCAACACATC
GTCTTCGAGGACGATCGCTGCAGCGACCCGACGCACTCGATGCTCTCCAAGGATCACTTCTCCAATGTTTGTCCG
CCCCTTGGGAACCTCCGTCACCGTCGAGCCTTGCTGACCGAGACGCGCAGATCCTGAACGAGATCGCGGGCCGGA
CGGCGGCCAAGATGCTACACTGGGTCGTGCCCCAGCTCATGGAGGCCATCGACGACGACGGCGTAGACGTGAACC
GCCTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCCCAGCGAGAGATGGGCAACGACGGCGTGGCCG
AGGCTCGGCAGCTCATCTACGGATGCGTGCAGGAGTGGTGGGGCGAGATGGACGACGCGCAGAGAGACGACTATC
GGCGAAAGCTCACGCGCGAGGGCGTCCAGAACGGAGACAACCACAAGGAGGGCGTCGACGACACGGGCCACGGAC
ACGGCTGCGTGGGCAAGCTCAAGATGCGTAAGCTGTATGGGCAGCAGGACACGCTCGAGAACAGAATCGCGGGCG
CGGCGGCCGACGCCATCTTCCAGACGGCCACGGGGGCAATCTCGGGCGTGGTGGAGCAGAACACGGGCATGAAGC
TGCCGTCGACTCAGGGCTCGCAACAGGCAGAGGAGCCCAAGGAGGAGGGCGGCTTCGGCGGCTTCATCGGCTCTC
TCCTCGGCGGCGCCTTTGGTGGGAAGGACACCGAGACGCGCGGCAGCCAGCGGCGGGAGGACGACGGCTCGGTGA
CGCAGACGCAGACGGAGTTCGGCCGGCAGGGTCACCACTACGGCCAGGCCGAGTACAGCCAGACGCAGCGGCCGG
ACGGCAGCAGCGAGTCGCATTACAGCCGGTTCGAGCAGCGGGAGTCGCACGGCGGGCGGCAGACGTCTGGCTACG
GCTACGAGGAGAGGACGGAGACGCGGCCGATGCACGGGGGCGGGTACGAGCAGCGGACCGAGCGGCAGGAGTACA
GAGGCTCCGGCCAGGGCGGCGGCGGCTACGGACGCGAGAGCCAGGGCGGCTACGGTGGCGGCGGCGAATACGGAC
GCGAGAGCCAGAACCAGAGCTATGGCCGCGAGAGCCAGCAGGGCGGCGGCTACGGTCAGGGCGGCGGCTACGGTC
GCGAGAGCCAGGGTGACGGCTACGGGCGCGAGAGGCGAAGTGACAGCTACGGCCGCGATAGTGGATATGGCCGCG
CCAGCCAGAGCGACAGCTACGGACGCGAGAGCTACGAGCGAGAGAGCCAGCGCAGCGGCCATGGTCGAGAGAGCT
ACGAGCGGGAAGGCCAGCGGGGTGGCTACGGTGGAGAGAGCCACGAGCGGGAGAGCCAGCACAGCGGCTACGGCC
GAGAGAGCCAGAGCAGCGGCTACGGTCAAGACAGCGGCTACGGGCGGGAGAGTCAGAGCGAGGCGTACGGTCAGA
GCGGTGGCTACGGCCGGCAGACGGAAGATTACGACAATAGAGGGTACGGGGGAAGCAAGGGTAGACGCGGAAATG
ACGACGACGACGACGACGACGACGACGACGACGAGGACTACGATAACAGACGTGGTCACGGAAGACGACGAGACG
ACAACAACTATGGGGACGAAGGCAGACGCGGCGGGCGGCGGGGAGACGACTACTACTCGTCGTCGTCGTCCAACT
CGCGGGGATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail