Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02324
Gene name
Locationscaffold_02:3257676..3258583
Strand-
Gene length (bp)907
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 7.3E-59 20 184
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 8.6E-36 20 135
PF00025 Arf ADP-ribosylation factor family 2.4E-15 16 182
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.5E-06 52 185
PF01926 MMR_HSR1 50S ribosome-binding GTPase 6.2E-06 21 129
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 4.3E-06 20 152

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole|Golgi apparatus 0.3754 0.1663 0.027 0.4092 0.1411 0.0099 0.1916 0.596 0.6878 0.0216

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup99
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2998
Ophiocordyceps australis 1348a (Ghana) OphauG2|3740
Ophiocordyceps australis 1348a (Ghana) OphauG2|3741
Ophiocordyceps australis map64 (Brazil) OphauB2|6102
Ophiocordyceps australis map64 (Brazil) OphauB2|6550
Ophiocordyceps australis map64 (Brazil) OphauB2|6551
Ophiocordyceps camponoti-floridani Ophcf2|01937
Ophiocordyceps camponoti-floridani Ophcf2|01938
Ophiocordyceps camponoti-floridani Ophcf2|02324 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7553
Ophiocordyceps kimflemingae Ophio5|5921
Ophiocordyceps kimflemingae Ophio5|5922
Ophiocordyceps kimflemingae Ophio5|6943
Ophiocordyceps subramaniannii Hirsu2|1834
Ophiocordyceps subramaniannii Hirsu2|1835
Ophiocordyceps subramaniannii Hirsu2|9586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02324
MAARGPVAARGINNRFAQFKLVLLGESAVGKSSIVLRFVKDQFDSFRESTIGAAFLTQTISLDDNTTVKFEIWDT
AGQERYKSLAPMYYRNANCAVVVYDITQSSSLDKAKAWVKELQRQANENIIIALAGNKLDLVTQQPDKRAISTNE
AEAYAREAGLLFFETSAKTAENVRELFTAIAKKLPLDQVGPRHARPGQRPGVSLNPENANTNVSGPCSC*
Coding >Ophcf2|02324
ATGGCAGCTCGAGGCCCTGTCGCCGCGCGCGGCATCAACAACCGCTTCGCACAGTTTAAGCTCGTTCTTCTCGGG
GAATCCGCTGTCGGAAAGAGCTCCATAGTTTTGCGCTTCGTCAAGGATCAGTTTGATTCCTTCCGGGAATCCACC
ATCGGCGCTGCTTTTCTCACCCAGACCATTTCGCTAGACGACAACACGACAGTCAAGTTTGAGATCTGGGATACG
GCCGGCCAAGAACGATACAAATCGTTGGCGCCCATGTATTATCGCAACGCCAACTGCGCCGTCGTCGTCTACGAT
ATAACGCAATCGTCATCTCTGGATAAGGCCAAGGCGTGGGTCAAGGAACTGCAGCGCCAAGCCAACGAGAACATC
ATCATCGCCCTCGCCGGCAACAAGCTCGACCTGGTCACTCAGCAGCCCGACAAGCGGGCCATTTCTACCAACGAG
GCCGAGGCCTACGCTCGCGAGGCCGGGCTCCTCTTCTTCGAGACGTCCGCTAAGACGGCAGAGAACGTTCGCGAG
CTGTTCACGGCCATTGCCAAGAAGCTGCCGCTGGATCAGGTCGGACCTCGGCACGCGAGGCCAGGCCAGCGACCG
GGCGTGAGCCTGAATCCCGAAAACGCCAACACCAACGTGAGCGGGCCCTGCAGTTGCTGA
Transcript >Ophcf2|02324
ATGGCAGCTCGAGGCCCTGTCGCCGCGCGCGGCATCAACAACCGCTTCGCACAGTTTAAGCTCGTTCTTCTCGGG
GAATCCGCTGTCGGAAAGAGCTCCATAGTTTTGCGCTTCGTCAAGGATCAGTTTGATTCCTTCCGGGAATCCACC
ATCGGCGCTGCTTTTCTCACCCAGACCATTTCGCTAGACGACAACACGACAGTCAAGTTTGAGATCTGGGATACG
GCCGGCCAAGAACGATACAAATCGTTGGCGCCCATGTATTATCGCAACGCCAACTGCGCCGTCGTCGTCTACGAT
ATAACGCAATCGTCATCTCTGGATAAGGCCAAGGCGTGGGTCAAGGAACTGCAGCGCCAAGCCAACGAGAACATC
ATCATCGCCCTCGCCGGCAACAAGCTCGACCTGGTCACTCAGCAGCCCGACAAGCGGGCCATTTCTACCAACGAG
GCCGAGGCCTACGCTCGCGAGGCCGGGCTCCTCTTCTTCGAGACGTCCGCTAAGACGGCAGAGAACGTTCGCGAG
CTGTTCACGGCCATTGCCAAGAAGCTGCCGCTGGATCAGGTCGGACCTCGGCACGCGAGGCCAGGCCAGCGACCG
GGCGTGAGCCTGAATCCCGAAAACGCCAACACCAACGTGAGCGGGCCCTGCAGTTGCTGA
Gene >Ophcf2|02324
ATGGCAGCTCGAGGCCCTGTCGCCGCGCGCGGCATCAACAACCGCTTCGCACAGTTTAAGCTCGTTCTTCTCGGT
ACGCATGCCCCCCAAACCCCCAGCCCCCTCCCCCAGACGCCGCTTGACACTGACGCGGGCATCAGGGGAATCCGC
TGTCGGAAAGGTGAAATACGATGGCGCCACTCCTGCCTCGAGATGACTGACTGACGCTCATCTTTATACATGCAG
AGCTCCATAGTTTTGCGCTTCGTCAAGGTACTTTATCTCCGAGTTGTGGATGGCGCACCAGGCGCTGACGCGACC
TTTGTTCTTTAGGATCAGTTTGATTCCTTCCGGGAATCCACCATCGGCGCTGCTTTTCTCACCCAGACCATTTCG
CTAGACGACAACACGACAGTCAAGTTTGAGATCTGGGATACGGCCGGCCAAGAACGATACAAATCGTTGGCGCCC
ATGTATTATCGCAACGCCAACTGCGCCGTCGTCGTCTACGATATAACGCAATCGGTGAGGTTCCCTCTCGCCGCG
GCATGGCGATTCGCCGGCTGACTCCCCGTCCCAGTCATCTCTGGATAAGGCCAAGGCGTGGGTCAAGGAACTGCA
GCGCCAAGCCAACGAGAACATCATCATCGCCCTCGCCGGCAACAAGCTCGACCTGGTCACTCAGCAGCCCGACAA
GCGGGCCATTTCTACCAACGAGGCCGAGGCCTACGCTCGCGAGGCCGGGCTCCTCTTCTTCGAGACGTCCGCTAA
GACGGCAGAGAACGTTCGCGAGCTGTTCACGGCCATTGCCAAGAAGCTGCCGCTGGATCAGGTCGGACCTCGGCA
CGCGAGGCCAGGCCAGCGACCGGGCGTGAGCCTGAATCCCGAAAACGCCAACACCAACGTGAGCGGGCCCTGCAG
TTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail