Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02307
Gene name
Locationscaffold_02:3208120..3209638
Strand-
Gene length (bp)1518
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04111 APG6 Apg6 BARA domain 1.1E-70 279 475
PF17675 APG6_N Apg6 coiled-coil region 3.6E-33 148 276

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5299 0.467 0.0066 0.0329 0.2223 0.0025 0.3988 0.559 0.5555 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1749
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6445
Ophiocordyceps australis map64 (Brazil) OphauB2|1903
Ophiocordyceps camponoti-floridani Ophcf2|02307 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4170
Ophiocordyceps kimflemingae Ophio5|7888
Ophiocordyceps subramaniannii Hirsu2|1624

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02307
MYCQKCRQPLRLDGSLEDLNPAAYDLLISSSSPSNSKPSPSSRSSTAPLQDHARRALYEKASRDAGPPSFKRHSG
SQPRDSAMSFIYLTESQVGHPQQLPQPKEGPTTPPRLRPSGSSVTKRASDADEMDRMNRLFEILSARSDIDHPIC
VDCTEILVDGLQTRLDMASKERDAYVRHLRQARAEQPTQEDIKAQQEALNKAERDRRAAMDELVKLERDKSALDE
EILALEEESKRLDREEESFWRERNEFSAKMAEFQAERDSVNAKYSNDSQLLDKLQRSNVYNDTFCISHDGSFATI
NGLRLGRLSSKPVDWPEINAAWGHALLLLVTVAEKLSYRFQGYDPQPMGSTSKIIRHELSSPASSRVGSRVTQPP
PKKHVLELYSSGDMPLGLTFMHRKFDNAMVAFLELVRQLGVHVQEKTEPTGNMLSLPYRIEGDKIGDVSIKLGIA
QDDGWTKACKLTLTCCKFLLAHASNVSSGTRNAYVRNP*
Coding >Ophcf2|02307
ATGTATTGTCAGAAATGTCGTCAGCCCTTGAGGCTGGACGGCTCCCTCGAGGACCTGAACCCGGCCGCCTATGAC
CTGCTGATATCATCCTCGTCGCCGTCAAATTCAAAGCCCTCACCCTCGTCCCGGTCGTCTACCGCACCACTGCAG
GACCACGCACGTCGCGCTCTGTACGAGAAGGCGTCTCGAGATGCCGGTCCTCCGTCCTTCAAGCGTCACAGCGGG
AGCCAGCCACGCGACTCAGCCATGTCCTTCATCTACCTTACCGAATCACAAGTAGGTCACCCGCAGCAGCTCCCG
CAGCCCAAGGAGGGCCCGACGACACCCCCCCGCCTTCGCCCGTCAGGCTCCAGCGTGACGAAGCGAGCCTCCGAC
GCCGACGAGATGGACAGGATGAACAGGCTATTCGAGATCCTGTCGGCCCGATCTGATATTGACCATCCAATCTGC
GTCGATTGCACCGAGATACTTGTGGATGGACTGCAAACGAGGCTCGACATGGCGTCCAAGGAGAGAGATGCCTAC
GTCAGACACTTGCGCCAGGCAAGGGCAGAGCAGCCGACGCAGGAGGACATCAAGGCTCAGCAGGAAGCGCTCAAC
AAGGCTGAAAGAGATCGGCGGGCAGCCATGGACGAGTTGGTGAAGCTTGAGCGGGACAAGAGTGCCCTCGACGAG
GAGATCCTGGCCCTGGAAGAGGAGTCGAAGCGGCTCGACAGGGAAGAGGAGTCCTTTTGGAGAGAGCGCAATGAA
TTTTCCGCCAAGATGGCCGAGTTTCAAGCGGAAAGGGACAGCGTCAACGCAAAGTACAGCAACGATTCGCAGCTG
CTCGACAAGCTGCAGCGATCCAACGTATACAACGACACGTTCTGCATCAGCCATGACGGAAGCTTCGCAACCATC
AACGGCTTACGGCTGGGAAGGCTGTCGAGCAAACCGGTTGACTGGCCAGAGATCAACGCCGCGTGGGGGCACGCC
CTGCTTCTCCTCGTCACTGTTGCCGAGAAGCTCAGCTACCGTTTTCAGGGCTACGACCCCCAGCCCATGGGAAGC
ACCTCCAAGATTATCCGGCACGAGTTGTCGAGTCCGGCCTCGAGCAGGGTCGGGTCCCGCGTCACGCAGCCGCCG
CCCAAGAAGCACGTGCTGGAGCTCTACAGCTCGGGCGACATGCCGCTGGGCCTGACTTTTATGCACCGCAAGTTC
GACAACGCCATGGTGGCCTTTCTCGAGCTGGTCCGGCAGCTGGGGGTGCACGTTCAGGAGAAGACGGAGCCGACG
GGGAATATGCTGAGTCTTCCGTACCGGATCGAGGGGGATAAGATCGGCGATGTGAGCATCAAGTTGGGCATCGCG
CAGGACGACGGCTGGACCAAGGCTTGCAAGCTCACCCTGACGTGCTGCAAGTTCCTTCTCGCCCACGCCAGCAAC
GTGAGCTCGGGCACGCGGAATGCCTACGTGAGGAATCCTTGA
Transcript >Ophcf2|02307
ATGTATTGTCAGAAATGTCGTCAGCCCTTGAGGCTGGACGGCTCCCTCGAGGACCTGAACCCGGCCGCCTATGAC
CTGCTGATATCATCCTCGTCGCCGTCAAATTCAAAGCCCTCACCCTCGTCCCGGTCGTCTACCGCACCACTGCAG
GACCACGCACGTCGCGCTCTGTACGAGAAGGCGTCTCGAGATGCCGGTCCTCCGTCCTTCAAGCGTCACAGCGGG
AGCCAGCCACGCGACTCAGCCATGTCCTTCATCTACCTTACCGAATCACAAGTAGGTCACCCGCAGCAGCTCCCG
CAGCCCAAGGAGGGCCCGACGACACCCCCCCGCCTTCGCCCGTCAGGCTCCAGCGTGACGAAGCGAGCCTCCGAC
GCCGACGAGATGGACAGGATGAACAGGCTATTCGAGATCCTGTCGGCCCGATCTGATATTGACCATCCAATCTGC
GTCGATTGCACCGAGATACTTGTGGATGGACTGCAAACGAGGCTCGACATGGCGTCCAAGGAGAGAGATGCCTAC
GTCAGACACTTGCGCCAGGCAAGGGCAGAGCAGCCGACGCAGGAGGACATCAAGGCTCAGCAGGAAGCGCTCAAC
AAGGCTGAAAGAGATCGGCGGGCAGCCATGGACGAGTTGGTGAAGCTTGAGCGGGACAAGAGTGCCCTCGACGAG
GAGATCCTGGCCCTGGAAGAGGAGTCGAAGCGGCTCGACAGGGAAGAGGAGTCCTTTTGGAGAGAGCGCAATGAA
TTTTCCGCCAAGATGGCCGAGTTTCAAGCGGAAAGGGACAGCGTCAACGCAAAGTACAGCAACGATTCGCAGCTG
CTCGACAAGCTGCAGCGATCCAACGTATACAACGACACGTTCTGCATCAGCCATGACGGAAGCTTCGCAACCATC
AACGGCTTACGGCTGGGAAGGCTGTCGAGCAAACCGGTTGACTGGCCAGAGATCAACGCCGCGTGGGGGCACGCC
CTGCTTCTCCTCGTCACTGTTGCCGAGAAGCTCAGCTACCGTTTTCAGGGCTACGACCCCCAGCCCATGGGAAGC
ACCTCCAAGATTATCCGGCACGAGTTGTCGAGTCCGGCCTCGAGCAGGGTCGGGTCCCGCGTCACGCAGCCGCCG
CCCAAGAAGCACGTGCTGGAGCTCTACAGCTCGGGCGACATGCCGCTGGGCCTGACTTTTATGCACCGCAAGTTC
GACAACGCCATGGTGGCCTTTCTCGAGCTGGTCCGGCAGCTGGGGGTGCACGTTCAGGAGAAGACGGAGCCGACG
GGGAATATGCTGAGTCTTCCGTACCGGATCGAGGGGGATAAGATCGGCGATGTGAGCATCAAGTTGGGCATCGCG
CAGGACGACGGCTGGACCAAGGCTTGCAAGCTCACCCTGACGTGCTGCAAGTTCCTTCTCGCCCACGCCAGCAAC
GTGAGCTCGGGCACGCGGAATGCCTACGTGAGGAATCCTTGA
Gene >Ophcf2|02307
ATGTATTGTCAGAAATGTCGTCAGCCCTTGAGGCTGGACGGCTCCCTCGAGGACCTGAACCCGGCCGCCTATGAC
CTGCTGATATGTCCGTCTCGCCCCCTTCCAAGTGTCTGCGAATATTCACCGTCTTCTTCAGCATCCTCGTCGCCG
TCAAATTCAAAGCCCTCACCCTCGTCCCGGTCGTCTACCGCACCACTGCAGGACCACGCACGTCGCGCTCTGTAC
GAGAAGGCGTCTCGAGATGCCGGTCCTCCGTCCTTCAAGCGTCACAGCGGGAGCCAGCCACGCGACTCAGCCATG
TCCTTCATCTACCTTACCGAATCACAAGTAGGTCACCCGCAGCAGCTCCCGCAGCCCAAGGAGGGCCCGACGACA
CCCCCCCGCCTTCGCCCGTCAGGCTCCAGCGTGACGAAGCGAGCCTCCGACGCCGACGAGATGGACAGGATGAAC
AGGCTATTCGAGATCCTGTCGGCCCGATCTGATATTGACCATCCAATCTGCGTCGATTGCACCGAGATACTTGTG
GATGGACTGCAAACGAGGCTCGACATGGCGTCCAAGGAGAGAGATGCCTACGTCAGACACTTGCGCCAGGCAAGG
GCAGAGCAGCCGACGCAGGAGGACATCAAGGCTCAGCAGGAAGCGCTCAACAAGGCTGAAAGAGATCGGCGGGCA
GCCATGGACGAGTTGGTGAAGCTTGAGCGGGACAAGAGTGCCCTCGACGAGGAGATCCTGGCCCTGGAAGAGGAG
TCGAAGCGGCTCGACAGGGAAGAGGAGTCCTTTTGGAGAGAGCGCAATGAATTTTCCGCCAAGATGGCCGAGTTT
CAAGCGGAAAGGGACAGCGTCAACGCAAAGTACAGCAACGATTCGCAGCTGCTCGACAAGCTGCAGCGATCCAAC
GTATACAACGACACGTTCTGCATCAGCCATGACGGAAGCTTCGCAACCATCAACGGCTTACGGCTGGGAAGGCTG
TCGAGCAAACCGGTTGACTGGCCAGAGATCAACGCCGCGTGGGGGCACGCCCTGCTTCTCCTCGTCACTGTTGCC
GAGAAGCTCAGCTACCGTTTTCAGGGCTACGACCCCCAGCCCATGGGAAGCACCTCCAAGATTATCCGGCACGAG
TTGTCGAGTCCGGCCTCGAGCAGGGTCGGGTCCCGCGTCACGCAGCCGCCGCCCAAGAAGCACGTGCTGGAGCTC
TACAGCTCGGGCGACATGCCGCTGGGCCTGACTTTTATGCACCGCAAGTTCGACAACGCCATGGTGGCCTTTCTC
GAGCTGGTCCGGCAGCTGGGGGTGCACGTTCAGGAGAAGACGGAGCCGACGGGGAATATGCTGAGTCTTCCGTAC
CGGATCGAGGGGGATAAGATCGGCGATGTGAGCATCAAGTTGGGCATCGCGCAGGACGACGGCTGGACCAAGGCT
TGCAAGCTCACCCTGACGTGCTGCAAGTTCCTTCTCGCCCACGCCAGCAACGTGAGCTCGGGCACGCGGAATGCC
TACGTGAGGAATCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail