Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02303
Gene name
Locationscaffold_02:3193414..3194776
Strand-
Gene length (bp)1362
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04088 Peroxin-13_N Peroxin 13, N-terminal region 5.1E-41 134 254

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005777 peroxisome Yes
GO:0016560 protein import into peroxisome matrix, docking Yes
GO:0042579 microbody No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0033036 macromolecule localization No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0008104 protein localization No
GO:0043227 membrane-bounded organelle No
GO:0051179 localization No
GO:0051641 cellular localization No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Transmembrane domain 0.2005 0.2944 0.0462 0.0923 0.2448 0.0087 0.8229 0.1367 0.4653 0.1539

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4138
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6367
Ophiocordyceps australis map64 (Brazil) OphauB2|1900
Ophiocordyceps camponoti-floridani Ophcf2|02303 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3628
Ophiocordyceps kimflemingae Ophio5|7884
Ophiocordyceps subramaniannii Hirsu2|8389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02303
MASPPKPWERPGAGAASTVAFSPASTSTPVTAAASSTSDTAPPLPERPSSLASTVNQNAAAYSRMGAGVGVGASP
YGGYGGAYSSPYSSPYSRFGGYGGGMYGGYGGYGGGMYGGGMYGGMGGMPGGQNDPNSLTNRFNNGTAATFQMLE
GIVTAFAGFSQMLESTYMATHSSFFAMVSVAEQFGNLRDTLGSILGIFTLMRWIRTLIAKLTGRPPPADATALTP
AAFARFEGRRAPAPRKQANPHAQAANPSSSSSPPLSASPTSCGLELQARKADLVAVLSKKDPVGNASEWWLCRSR
DGRQGYLPCTYLELLRRPGSEVKTIQAADVQKSVVATAEEGKKEYATADGMQRSHFYS*
Coding >Ophcf2|02303
ATGGCCTCGCCGCCCAAGCCATGGGAGAGGCCTGGCGCCGGCGCGGCTTCGACTGTTGCCTTCTCACCCGCTTCG
ACTTCGACTCCTGTGACGGCAGCGGCTTCGTCGACGTCAGATACGGCGCCGCCTCTGCCGGAGAGACCCTCATCT
CTCGCCTCGACCGTCAATCAAAACGCGGCGGCCTACAGCCGGATGGGCGCCGGCGTCGGCGTCGGGGCATCACCA
TACGGAGGCTACGGAGGCGCCTACTCGTCGCCCTACTCCAGCCCTTACTCGCGCTTCGGGGGCTACGGGGGGGGC
ATGTATGGCGGCTACGGCGGCTACGGAGGCGGCATGTATGGTGGTGGCATGTACGGCGGCATGGGCGGTATGCCG
GGCGGGCAGAACGATCCGAATAGTCTTACGAACCGGTTCAACAACGGGACGGCGGCTACTTTCCAGATGCTTGAG
GGTATCGTCACTGCGTTTGCGGGCTTTTCGCAGATGCTCGAGAGCACCTACATGGCCACCCACTCCAGCTTCTTC
GCCATGGTCTCGGTAGCAGAACAATTCGGCAACCTCCGCGACACCCTCGGCTCCATCCTCGGCATCTTCACCCTC
ATGCGCTGGATCCGCACCCTCATAGCCAAGCTCACCGGCCGGCCCCCCCCCGCCGACGCAACGGCCCTCACACCC
GCCGCCTTCGCCCGCTTCGAAGGCCGACGCGCCCCGGCCCCCCGGAAGCAGGCCAACCCCCACGCGCAAGCCGCA
AACCCCTCCTCTTCTTCCTCGCCGCCGCTTTCGGCCTCCCCTACCTCATGCGGTCTCGAACTCCAAGCCCGAAAA
GCAGACCTCGTCGCCGTCCTCTCCAAGAAAGACCCCGTCGGCAACGCAAGCGAATGGTGGCTGTGTCGCTCCCGC
GATGGTCGTCAGGGCTACCTACCCTGCACCTACCTCGAGCTGCTGCGACGACCCGGCTCGGAAGTCAAGACGATA
CAGGCGGCTGATGTGCAGAAGTCGGTGGTCGCGACGGCTGAGGAAGGGAAGAAGGAGTATGCCACTGCTGATGGG
ATGCAGAGGAGTCACTTCTACTCGTGA
Transcript >Ophcf2|02303
ATGGCCTCGCCGCCCAAGCCATGGGAGAGGCCTGGCGCCGGCGCGGCTTCGACTGTTGCCTTCTCACCCGCTTCG
ACTTCGACTCCTGTGACGGCAGCGGCTTCGTCGACGTCAGATACGGCGCCGCCTCTGCCGGAGAGACCCTCATCT
CTCGCCTCGACCGTCAATCAAAACGCGGCGGCCTACAGCCGGATGGGCGCCGGCGTCGGCGTCGGGGCATCACCA
TACGGAGGCTACGGAGGCGCCTACTCGTCGCCCTACTCCAGCCCTTACTCGCGCTTCGGGGGCTACGGGGGGGGC
ATGTATGGCGGCTACGGCGGCTACGGAGGCGGCATGTATGGTGGTGGCATGTACGGCGGCATGGGCGGTATGCCG
GGCGGGCAGAACGATCCGAATAGTCTTACGAACCGGTTCAACAACGGGACGGCGGCTACTTTCCAGATGCTTGAG
GGTATCGTCACTGCGTTTGCGGGCTTTTCGCAGATGCTCGAGAGCACCTACATGGCCACCCACTCCAGCTTCTTC
GCCATGGTCTCGGTAGCAGAACAATTCGGCAACCTCCGCGACACCCTCGGCTCCATCCTCGGCATCTTCACCCTC
ATGCGCTGGATCCGCACCCTCATAGCCAAGCTCACCGGCCGGCCCCCCCCCGCCGACGCAACGGCCCTCACACCC
GCCGCCTTCGCCCGCTTCGAAGGCCGACGCGCCCCGGCCCCCCGGAAGCAGGCCAACCCCCACGCGCAAGCCGCA
AACCCCTCCTCTTCTTCCTCGCCGCCGCTTTCGGCCTCCCCTACCTCATGCGGTCTCGAACTCCAAGCCCGAAAA
GCAGACCTCGTCGCCGTCCTCTCCAAGAAAGACCCCGTCGGCAACGCAAGCGAATGGTGGCTGTGTCGCTCCCGC
GATGGTCGTCAGGGCTACCTACCCTGCACCTACCTCGAGCTGCTGCGACGACCCGGCTCGGAAGTCAAGACGATA
CAGGCGGCTGATGTGCAGAAGTCGGTGGTCGCGACGGCTGAGGAAGGGAAGAAGGAGTATGCCACTGCTGATGGG
ATGCAGAGGAGTCACTTCTACTCGTGA
Gene >Ophcf2|02303
ATGGCCTCGCCGCCCAAGCCATGGGAGAGGCCTGGCGCCGGCGCGGCTTCGAGTGCGTTTTGCCCCGTCGATTAC
ACTCCCTCGTCCGAGACTGATCTCATTGCAGCTGTTGCCTTCTCACCCGCTTCGACTTCGACTCCTGTGACGGCA
GCGGCTTCGTCGACGTCAGATACGGCGCCGCCTCTGCCGGAGAGACCCTCATCTCTCGCCTCGACCGTCAATCAA
AACGCGGCGGCCTACAGCCGGATGGGCGCCGGCGTCGGCGTCGGGGCATCACCATACGGAGGCTACGGAGGCGCC
TACTCGTCGCCCTACTCCAGCCCTTACTCGCGCTTCGGGGGCTACGGGGGGGGCATGTATGGCGGCTACGGCGGC
TACGGAGGCGGCATGTATGGTGGTGGCATGTACGGCGGCATGGGCGGTATGCCGGGCGGGCAGAACGATCCGAAT
AGTCTTACGAACCGGTTCAACAACGGGACGGCGGCTACTTTCCAGATGCTTGAGGGTATCGTCACTGCGTTTGCG
GGCTTTTCGCAGATGCTCGAGAGCACCTACATGGCCACCCACTCCAGCTTCTTCGGTGAGTTTTCTTCTCTTAAC
CAGCCATCCTCCTCCTCCTCCGCCGCACGTCTGCTGACCAAGACGTCCTCTCGCAAAAGCCATGGTCTCGGTAGC
AGAACAATTCGGCAACCTCCGCGACACCCTCGGCTCCATCCTCGGCATCTTCACCCTCATGCGCTGGATCCGCAC
CCTCATAGCCAAGCTCACCGGCCGGCCCCCCCCCGCCGACGCAACGGCCCTCACACCCGCCGCCTTCGCCCGCTT
CGAAGGCCGACGCGCCCCGGCCCCCCGGAAGCAGGCCAACCCCCACGCGCAAGCCGCAAACCCCTCCTCTTCTTC
CTCGCCGCCGCTTTCGGCCTCCCCTACCTCATGTCCAAGATGATTCGCTCGCTGGCTGCCTCGCACGAAGAGGAA
GAGCGCAAACGACTCCTCCAACAGCAACAGCAACAGCAACAGGATCCCATCGACCCTTCCAAGCTCGAATTCTGC
CGTCTTCTCTACGACTTCCTCCCCTCGTCCGAAGGCGGTCTCGAACTCCAAGCCCGAAAAGCAGACCTCGTCGCC
GTCCTCTCCAAGAAAGACCCCGTCGGCAACGCAAGCGAATGGTGGCTGTGTCGCTCCCGCGATGGTCGTCAGGGC
TACCTACCCTGCACCTACCTCGAGCTGCTGCGACGACCCGGCTCGGAAGTCAAGACGATACAGGCGGCTGATGTG
CAGAAGTCGGTGGTCGCGACGGCTGAGGAAGGGAAGAAGGAGTATGCCACTGCTGATGGGATGCAGAGGAGTCAC
TTCTACTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail