Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02301
Gene name
Locationscaffold_02:3189277..3190041
Strand+
Gene length (bp)764
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 2.8E-05 139 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 116 135 19
3 145 167 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 122.37 68.68 176.06
Alive In ants, during behavior modification 35.78 15.84 55.72
Dead In ants, recently dead 43.87 20.51 67.23

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.351209 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02301
MKVLSKEEEAAHFSVVLNGGIVGGIAGFGLGLGGVIFASRRYPAFRGLTLPFRTFLVTSSTTFGAIVNADRQSTR
FQRAQHVDSDYRDASQRAAEMIRANESKYQSFMAWGREHRYSIVFASWVASMGVALTIVGRAPMSTPQKLVQARV
YAQALTLAVLVVSAVFEMSDAKDGSGRWETVLVVDPNDPEHKHLIEKKVHKEDYEGQDMWKDMVEAEEQRLKAKE
RKATKS*
Coding >Ophcf2|02301
ATGAAAGTGCTCAGCAAGGAAGAAGAGGCGGCGCACTTTTCCGTCGTTCTCAACGGTGGTATCGTCGGCGGTATC
GCTGGCTTCGGTCTCGGGCTCGGTGGCGTCATCTTCGCCTCTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTT
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCCCAGCATGTCGATAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGCCAAC
GAGTCCAAGTATCAGAGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATTGTCTTCGCTTCCTGGGTCGCT
AGCATGGGCGTCGCTCTGACAATTGTCGGCCGCGCCCCAATGTCTACGCCCCAGAAGCTCGTCCAGGCTCGTGTG
TACGCTCAGGCGCTGACGCTCGCCGTCCTTGTGGTCTCTGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGATCCCAACGACCCGGAGCACAAGCACCTCATCGAGAAGAAGGTGCAC
AAGGAGGATTACGAGGGCCAGGACATGTGGAAGGACATGGTCGAGGCCGAGGAGCAACGGCTCAAGGCCAAAGAG
CGCAAAGCTACCAAGTCCTAG
Transcript >Ophcf2|02301
ATGAAAGTGCTCAGCAAGGAAGAAGAGGCGGCGCACTTTTCCGTCGTTCTCAACGGTGGTATCGTCGGCGGTATC
GCTGGCTTCGGTCTCGGGCTCGGTGGCGTCATCTTCGCCTCTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTT
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCCCAGCATGTCGATAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGCCAAC
GAGTCCAAGTATCAGAGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATTGTCTTCGCTTCCTGGGTCGCT
AGCATGGGCGTCGCTCTGACAATTGTCGGCCGCGCCCCAATGTCTACGCCCCAGAAGCTCGTCCAGGCTCGTGTG
TACGCTCAGGCGCTGACGCTCGCCGTCCTTGTGGTCTCTGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGATCCCAACGACCCGGAGCACAAGCACCTCATCGAGAAGAAGGTGCAC
AAGGAGGATTACGAGGGCCAGGACATGTGGAAGGACATGGTCGAGGCCGAGGAGCAACGGCTCAAGGCCAAAGAG
CGCAAAGCTACCAAGTCCTAG
Gene >Ophcf2|02301
ATGAAAGTGCTCAGCAAGGAAGAAGAGGCGGCGCACTTTTCCGTCGTTCTCAACGGTGGTATCGTCGGCGGTATC
GCTGGCTTCGGTCTCGGGCTCGGTGGCGTCATCTTCGCCTCTCGTCGGTATCCGGCTTTTCGCGGCCTGACGCTT
CCGTTTCGCACTTTTCTCGTCACTTCGAGTACGACGTTTGGCGCCATTGTCAACGCTGATCGGCAGAGCACTCGC
TTCCAGCGCGCCCAGCATGTCGATAGCGACTATCGGGATGCCAGCCAGCGTGCTGCCGAGATGATTCGCGCCAAC
GAGTCCAAGTATCAGAGCTTCATGGCCTGGGGCCGCGAGCATCGCTACTCTATTGTCTTCGCTTCCTGGGTCGCT
AGCATGGGCGTCGCTCTGACAATTGTCGGCCGCGCCCCAATGTCTACGCCCCAGAAGCTCGTCCAGGCTCGTGTG
TACGCTCAGGCGCTGACGCTCGCCGTCCTTGTGGTCTCTGCCGTCTTCGAGATGTCCGACGCCAAAGACGGCAGT
GGCCGTTGGGAGACGGTTCTCGTTGTCGATCCCAACGACCCGGAGCACAAGCACCTCATCGAGAAGAAGGTGCAC
AAGGAGGATTACGAGGGCCAGGACATGTGGAAGGGTACGACTGCCTGCACATCGTTCACCAGTTGTCTTCTTCTG
AGTGGCCCCTATGCTGACTTGTCCCAGACATGGTCGAGGCCGAGGAGCAACGGCTCAAGGCCAAAGAGCGCAAAG
CTACCAAGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail