Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02286
Gene name
Locationscaffold_02:3141866..3142562
Strand+
Gene length (bp)696
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08510 PIG-P PIG-P 4.5E-54 85 223

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 88 107 19
2 127 149 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 28.47 11.88 45.06
Alive In ants, during behavior modification 15.01 4.94 25.08
Dead In ants, recently dead 16.18 5.19 27.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.019223 yes
Alive Dead 0.814057 no
Dead Fungus 0.043909 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02286
MSVSSEEKDEYLSDGQSSDSSGHEWPARPLSQTYFAPPFYGRPPTPLPPSPSLTSLLRPSRPTTPDASDDDNMAP
VPRASPQVPTYEYYGFVLYLFSSLTFLLWLLWSYLPAPFLHGLGIYYYPNRWWALAIPAFITMTLCYIYVALASY
NTEILTLPMASVETIVDGAGKLAVIDAKGRLRGSSKRERKCDSNGRLRWREVWNEGTDAVMDIPLAGVCEVLYGD
GREEHA*
Coding >Ophcf2|02286
ATGTCGGTCTCATCGGAAGAGAAAGACGAGTACCTGTCGGACGGCCAATCTTCCGACTCGTCGGGCCACGAATGG
CCGGCACGTCCCCTGTCACAGACCTACTTTGCGCCGCCCTTCTATGGCCGACCACCGACGCCGCTGCCCCCTTCG
CCGTCATTGACGTCACTCCTTCGACCGTCGCGTCCGACGACGCCAGATGCCTCGGACGACGATAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACGTACGAGTACTACGGCTTCGTGCTGTACCTCTTCAGCAGCTTGACC
TTTCTTCTCTGGCTTCTATGGAGCTACCTGCCGGCGCCCTTCTTGCACGGCCTGGGCATCTACTACTACCCGAAC
CGATGGTGGGCGCTTGCCATCCCGGCCTTTATAACCATGACGCTGTGCTACATCTACGTGGCGCTGGCCTCTTAC
AACACGGAGATTCTGACGCTTCCTATGGCCAGCGTGGAGACAATCGTCGACGGTGCGGGAAAGCTGGCTGTCATC
GATGCCAAGGGCCGGCTTCGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGACGCCTGAGATGGAGG
GAGGTCTGGAACGAGGGTACTGATGCCGTGATGGACATTCCTCTTGCGGGAGTGTGCGAGGTTCTTTACGGAGAC
GGGCGCGAAGAACACGCCTGA
Transcript >Ophcf2|02286
ATGTCGGTCTCATCGGAAGAGAAAGACGAGTACCTGTCGGACGGCCAATCTTCCGACTCGTCGGGCCACGAATGG
CCGGCACGTCCCCTGTCACAGACCTACTTTGCGCCGCCCTTCTATGGCCGACCACCGACGCCGCTGCCCCCTTCG
CCGTCATTGACGTCACTCCTTCGACCGTCGCGTCCGACGACGCCAGATGCCTCGGACGACGATAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACGTACGAGTACTACGGCTTCGTGCTGTACCTCTTCAGCAGCTTGACC
TTTCTTCTCTGGCTTCTATGGAGCTACCTGCCGGCGCCCTTCTTGCACGGCCTGGGCATCTACTACTACCCGAAC
CGATGGTGGGCGCTTGCCATCCCGGCCTTTATAACCATGACGCTGTGCTACATCTACGTGGCGCTGGCCTCTTAC
AACACGGAGATTCTGACGCTTCCTATGGCCAGCGTGGAGACAATCGTCGACGGTGCGGGAAAGCTGGCTGTCATC
GATGCCAAGGGCCGGCTTCGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGACGCCTGAGATGGAGG
GAGGTCTGGAACGAGGGTACTGATGCCGTGATGGACATTCCTCTTGCGGGAGTGTGCGAGGTTCTTTACGGAGAC
GGGCGCGAAGAACACGCCTGA
Gene >Ophcf2|02286
ATGTCGGTCTCATCGGAAGAGAAAGACGAGTACCTGTCGGACGGCCAATCTTCCGACTCGTCGGGCCACGAATGG
CCGGCACGTCCCCTGTCACAGACCTACTTTGCGCCGCCCTTCTATGGCCGACCACCGACGCCGCTGCCCCCTTCG
CCGTCATTGACGTCACTCCTTCGACCGTCGCGTCCGACGACGCCAGATGCCTCGGACGACGATAACATGGCGCCG
GTGCCCCGCGCGTCGCCCCAGGTGCCGACGTACGAGTACTACGGCTTCGTGCTGTACCTCTTCAGCAGCTTGACC
TTTCTTCTCTGGCTTCTATGGAGCTACCTGCCGGCGCCCTTCTTGCACGGCCTGGGCATCTACTACTACCCGAAC
CGATGGTGGGCGCTTGCCATCCCGGCCTTTATAACCATGACGCTGTGCTACATCTACGTGGCGCTGGCCTCTTAC
AACACGGAGATTCTGACGCTTCCTATGGCCAGCGTGGAGACAATCGTCGACGGTGCGGGAAAGCTGGCTGTCATC
GATGCCAAGGGCCGGCTTCGTGGCAGCAGCAAGAGAGAGAGGAAGTGTGACAGCAACGGACGCCTGAGATGGAGG
GAGGTCTGGAACGAGGGTACTGATGCCGTGATGGACATTCCTCTTGCGGGAGTGTGCGAGGTTCTTTACGGAGAC
GGGCGCGAAGAACACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail