Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02284
Gene name
Locationscaffold_02:3134191..3138242
Strand-
Gene length (bp)4051
Transcript length (bp)3990
Coding sequence length (bp)3990
Protein length (aa) 1330

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.0E-22 989 1137
PF00072 Response_reg Response regulator receiver domain 2.3E-21 1187 1313
PF08448 PAS_4 PAS fold 4.3E-05 728 838
PF00512 HisKA His Kinase A (phospho-acceptor) domain 3.0E-07 859 936
PF13188 PAS_8 PAS domain 6.8E-04 720 784

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0140299 small molecule sensor activity No
GO:0050794 regulation of cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0016740 transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0004673 protein histidine kinase activity No
GO:0035556 intracellular signal transduction No
GO:0004672 protein kinase activity No
GO:0003674 molecular_function No
GO:0065007 biological regulation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4925 0.7861 0.2604 0.0367 0.08 0.0042 0.1431 0.0234 0.0229 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2768
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5604
Ophiocordyceps australis map64 (Brazil) OphauB2|3154
Ophiocordyceps camponoti-floridani Ophcf2|02284 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3767
Ophiocordyceps kimflemingae Ophio5|7010
Ophiocordyceps subramaniannii Hirsu2|4409

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02284
MDQAPAKKPRTLASPPRRFEMPSSVMMPPQFLPSSNDGAFSPSPLFFSHTPPRPLGRPTNSAPPDVTAGMLSRAR
DDAAAITTVKLPRGSVCSSPAMTGSSMSSSLDLSLPTLSPDGRSLPASLQKVQSIGAIEFVEHDERPTFLVDLSN
PPDVKQSGLNILYYNGALRSCADMYALLSADNQNTTTQAFDRFKAWAYHPHISDSSVPFPTHRHYGGTDWTSTTL
RQRFRFISANSTAHASRPRLSRPSSVESVPSAVAESPLGQSMPITPEGDNSDLPDYFGDAATAALKPGLAPTLND
IQTETKYSDDRRHPDDFTNQVLQLQPTKSVFDWTRIPITDTLPEHIKFAKSVDWASTPLGPMSEWTSDLRAMSNL
IMGSPHPAAMYWGPDLICIYNAAYIELAGQKHPSLMGMSYKDGWSEIWSEIEPIFKSATECGQAMMKHDNRLFLH
RHGFLEETFFSWAIVPLVGNEGEVVGLYNPAFEHTLRRINDRRMLTLREIGERTAAATTVSGFWPQVQKGLEYNE
NDVPFSLIYSIKEEAESEVSSLQSGSFMHSPQVALEGSPGVPEGHAAAPPYLDLRTSDEGFAPYMRQCMQGGSEP
LVLSASDDSLPKHLVEGIEGRGFGDACTNVVIFPVVPTTKEAATGFIVLGLNPRRPYDDNYKLFIHLLSRQLATS
MASVVLFEEEIRRGQRAARLAALDRQELSMQLLLRTQEANESEYRFTRMAEYAPVGMFIADCHGRITYCNDMWWQ
ISRHSRFDETELAWMNSVRDEDRPPLEEAWRKLLRDRVTISVEFRFNHSQQSGVNTIDTWVLMSAFPEKNADGVL
KSIFGCITDISSQKWAEKVQSERREEAVELKRQQENFIDITSHEMRNPLSAILQCADQVSNNIVTFSAHKDPAQL
ETFLESCLDAANTINLCASHQKRIVDDILTLSKLDSNLLAVTPVDEQPVKAVQRALKMFESELQAHDIELEFSAD
DSFERHGVEWAKLDPSRLRQVLINLMTNAIKFTQGRDKRKIVVSLSASKDISEVTSQGVLYFDRNGGPRMTGMDI
DNEADWGAGERINIHCSVEDTGPGLAEEELKVLFQRFQQATPRTHVKYGGSGLGLFISRILTEMQGGQIGVTSAR
GKGSKFNFYIQSRKSLDPPSSYEPISPFRIGRKTQALAAASPSSTQSARSATGKDGQPLFDVLIVEDNIVNQKVL
QRQLRSWGNNTFVANHGREALQTLEKSRFWAGQEAEGVDISVILMDLEMPVMDGMTCARRIRELEREGTIVKHIP
IIAVTAYARPEQIEDAKAAGIDDVISKPFRIPELMPKIEELVGRWRNLAVPAGA*
Coding >Ophcf2|02284
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCTTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
ATGATGCCTCCCCAATTCTTACCGTCGTCCAATGACGGGGCCTTTTCGCCTTCGCCCCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCTCCTCCGGACGTGACGGCCGGCATGCTGTCCCGCGCACGT
GATGACGCGGCCGCTATCACCACCGTCAAGCTTCCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCATGAGTTCCTCGCTCGACTTGTCGCTTCCCACACTGAGCCCCGATGGTCGCAGCCTACCCGCCAGCTTGCAA
AAGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGAGACCGACCTTTCTCGTCGATCTGTCTAAC
CCACCGGATGTGAAACAGTCGGGGCTGAACATACTGTATTACAACGGCGCCCTGCGATCTTGTGCCGACATGTAC
GCCTTGCTCTCCGCCGACAACCAAAATACCACAACTCAAGCCTTTGATCGTTTCAAGGCCTGGGCCTACCACCCT
CATATCAGCGATTCCTCCGTTCCGTTCCCTACCCATCGTCACTATGGTGGCACCGACTGGACCTCTACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAACTCCACGGCTCACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCT
GTCGAATCGGTTCCTTCTGCTGTGGCCGAATCTCCTCTCGGCCAGTCAATGCCAATCACTCCAGAAGGGGATAAC
TCGGACCTTCCAGACTACTTCGGCGATGCTGCCACCGCGGCCCTTAAGCCTGGCCTTGCCCCGACGCTCAACGAT
ATCCAAACCGAGACAAAGTATAGCGACGATCGCCGGCATCCGGACGACTTTACCAACCAGGTGCTGCAGCTGCAA
CCTACTAAATCCGTGTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTTGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGACCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATTATGGGCAGCCCTCATCCTGCCGCCATGTACTGGGGTCCCGATTTGATTTGCATATACAACGCCGCATATATC
GAGCTTGCCGGGCAAAAGCATCCGTCGCTCATGGGCATGTCGTATAAAGACGGCTGGTCTGAGATCTGGAGCGAG
ATTGAGCCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGATAACCGACTCTTCCTCCAT
CGTCACGGCTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTACCCCTGGTCGGGAACGAGGGCGAGGTGGTT
GGACTGTACAATCCAGCCTTCGAGCACACGCTACGTCGAATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCTGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAAGGGCCTCGAGTACAATGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAGCGGAGAGCGAGGTGTCGTCTCTACAATCGGGC
AGCTTCATGCACTCACCGCAAGTCGCGCTCGAGGGCTCACCCGGCGTGCCCGAGGGGCATGCTGCCGCTCCCCCT
TATCTGGACTTGAGGACGTCGGACGAAGGCTTCGCGCCGTATATGCGGCAGTGTATGCAAGGGGGCAGCGAGCCG
TTGGTCCTGTCTGCGAGCGACGACTCCCTTCCGAAGCACCTCGTCGAGGGCATCGAAGGACGGGGCTTTGGCGAT
GCTTGCACCAACGTCGTCATCTTTCCCGTCGTACCAACGACTAAAGAGGCAGCCACCGGCTTCATTGTGCTCGGT
CTGAACCCTCGGCGACCGTACGACGATAACTACAAGCTCTTCATCCACCTTCTCTCTCGGCAGTTGGCGACGTCG
ATGGCTTCGGTGGTGCTCTTCGAAGAAGAGATTCGTCGAGGCCAGCGGGCGGCGCGACTGGCGGCTCTGGATCGC
CAGGAGCTGTCGATGCAGCTCTTGTTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGCCACGGTCGCATCACCTACTGCAACGATATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAGCTCGCGTGGATGAACAGCGTCAGAGATGAGGACAGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCAGGGACCGCGTCACCATCTCGGTCGAGTTCCGCTTCAATCACAGCCAG
CAGAGTGGCGTCAACACCATCGACACCTGGGTACTCATGAGCGCCTTTCCCGAAAAGAATGCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACCGACATCTCGTCCCAGAAGTGGGCCGAGAAGGTACAGAGCGAGAGGAGGGAA
GAGGCCGTTGAGCTCAAGCGTCAGCAGGAGAACTTCATTGACATCACCAGCCACGAGATGCGAAACCCGCTTTCG
GCCATCTTGCAGTGCGCCGATCAAGTATCCAACAACATTGTCACCTTTTCCGCCCACAAGGATCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATTGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCTAACCTCTTGGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGCCGAT
GACAGCTTCGAGAGGCACGGCGTCGAATGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACTCAGGGCCGCGACAAGCGTAAGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATTTCCGAGGTGACCAGCCAGGGTGTTCTCTACTTTGACCGCAACGGCGGCCCCCGCATGACGGGCATGGATATC
GACAACGAGGCAGACTGGGGCGCTGGTGAACGCATCAACATACACTGCTCGGTAGAGGACACGGGGCCCGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTTCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATTCTAACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTTAACTTTTACATCCAGAGCCGCAAGAGTCTGGACCCTCCATCAAGCTACGAACCCATA
TCGCCCTTCCGGATCGGCCGGAAGACGCAGGCTCTGGCAGCGGCCTCGCCGAGCAGCACCCAGTCCGCCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGACAACATCGTCAACCAAAAGGTGCTT
CAGAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAATCACGGGCGCGAGGCTCTCCAGACGCTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATTCTCATGGACTTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCTCGGCGGATCCGTGAGCTCGAGAGGGAGGGTACGATTGTGAAGCACATACCC
ATCATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGACGACGTCATC
TCGAAGCCGTTCCGCATCCCGGAGCTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGGAACCTGGCCGTA
CCAGCCGGAGCGTGA
Transcript >Ophcf2|02284
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCTTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
ATGATGCCTCCCCAATTCTTACCGTCGTCCAATGACGGGGCCTTTTCGCCTTCGCCCCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCTCCTCCGGACGTGACGGCCGGCATGCTGTCCCGCGCACGT
GATGACGCGGCCGCTATCACCACCGTCAAGCTTCCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCATGAGTTCCTCGCTCGACTTGTCGCTTCCCACACTGAGCCCCGATGGTCGCAGCCTACCCGCCAGCTTGCAA
AAGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGAGACCGACCTTTCTCGTCGATCTGTCTAAC
CCACCGGATGTGAAACAGTCGGGGCTGAACATACTGTATTACAACGGCGCCCTGCGATCTTGTGCCGACATGTAC
GCCTTGCTCTCCGCCGACAACCAAAATACCACAACTCAAGCCTTTGATCGTTTCAAGGCCTGGGCCTACCACCCT
CATATCAGCGATTCCTCCGTTCCGTTCCCTACCCATCGTCACTATGGTGGCACCGACTGGACCTCTACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAACTCCACGGCTCACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCT
GTCGAATCGGTTCCTTCTGCTGTGGCCGAATCTCCTCTCGGCCAGTCAATGCCAATCACTCCAGAAGGGGATAAC
TCGGACCTTCCAGACTACTTCGGCGATGCTGCCACCGCGGCCCTTAAGCCTGGCCTTGCCCCGACGCTCAACGAT
ATCCAAACCGAGACAAAGTATAGCGACGATCGCCGGCATCCGGACGACTTTACCAACCAGGTGCTGCAGCTGCAA
CCTACTAAATCCGTGTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTTGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGACCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATTATGGGCAGCCCTCATCCTGCCGCCATGTACTGGGGTCCCGATTTGATTTGCATATACAACGCCGCATATATC
GAGCTTGCCGGGCAAAAGCATCCGTCGCTCATGGGCATGTCGTATAAAGACGGCTGGTCTGAGATCTGGAGCGAG
ATTGAGCCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGATAACCGACTCTTCCTCCAT
CGTCACGGCTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTACCCCTGGTCGGGAACGAGGGCGAGGTGGTT
GGACTGTACAATCCAGCCTTCGAGCACACGCTACGTCGAATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCTGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAAGGGCCTCGAGTACAATGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAGCGGAGAGCGAGGTGTCGTCTCTACAATCGGGC
AGCTTCATGCACTCACCGCAAGTCGCGCTCGAGGGCTCACCCGGCGTGCCCGAGGGGCATGCTGCCGCTCCCCCT
TATCTGGACTTGAGGACGTCGGACGAAGGCTTCGCGCCGTATATGCGGCAGTGTATGCAAGGGGGCAGCGAGCCG
TTGGTCCTGTCTGCGAGCGACGACTCCCTTCCGAAGCACCTCGTCGAGGGCATCGAAGGACGGGGCTTTGGCGAT
GCTTGCACCAACGTCGTCATCTTTCCCGTCGTACCAACGACTAAAGAGGCAGCCACCGGCTTCATTGTGCTCGGT
CTGAACCCTCGGCGACCGTACGACGATAACTACAAGCTCTTCATCCACCTTCTCTCTCGGCAGTTGGCGACGTCG
ATGGCTTCGGTGGTGCTCTTCGAAGAAGAGATTCGTCGAGGCCAGCGGGCGGCGCGACTGGCGGCTCTGGATCGC
CAGGAGCTGTCGATGCAGCTCTTGTTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGCCACGGTCGCATCACCTACTGCAACGATATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAGCTCGCGTGGATGAACAGCGTCAGAGATGAGGACAGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCAGGGACCGCGTCACCATCTCGGTCGAGTTCCGCTTCAATCACAGCCAG
CAGAGTGGCGTCAACACCATCGACACCTGGGTACTCATGAGCGCCTTTCCCGAAAAGAATGCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACCGACATCTCGTCCCAGAAGTGGGCCGAGAAGGTACAGAGCGAGAGGAGGGAA
GAGGCCGTTGAGCTCAAGCGTCAGCAGGAGAACTTCATTGACATCACCAGCCACGAGATGCGAAACCCGCTTTCG
GCCATCTTGCAGTGCGCCGATCAAGTATCCAACAACATTGTCACCTTTTCCGCCCACAAGGATCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATTGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCTAACCTCTTGGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGCCGAT
GACAGCTTCGAGAGGCACGGCGTCGAATGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACTCAGGGCCGCGACAAGCGTAAGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATTTCCGAGGTGACCAGCCAGGGTGTTCTCTACTTTGACCGCAACGGCGGCCCCCGCATGACGGGCATGGATATC
GACAACGAGGCAGACTGGGGCGCTGGTGAACGCATCAACATACACTGCTCGGTAGAGGACACGGGGCCCGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTTCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATTCTAACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTTAACTTTTACATCCAGAGCCGCAAGAGTCTGGACCCTCCATCAAGCTACGAACCCATA
TCGCCCTTCCGGATCGGCCGGAAGACGCAGGCTCTGGCAGCGGCCTCGCCGAGCAGCACCCAGTCCGCCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGACAACATCGTCAACCAAAAGGTGCTT
CAGAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAATCACGGGCGCGAGGCTCTCCAGACGCTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATTCTCATGGACTTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCTCGGCGGATCCGTGAGCTCGAGAGGGAGGGTACGATTGTGAAGCACATACCC
ATCATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGACGACGTCATC
TCGAAGCCGTTCCGCATCCCGGAGCTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGGAACCTGGCCGTA
CCAGCCGGAGCGTGA
Gene >Ophcf2|02284
ATGGACCAGGCCCCCGCCAAGAAGCCCCGGACCTTGGCTTCGCCGCCCCGCCGCTTCGAGATGCCGTCCTCAGTC
ATGATGCCTCCCCAATTCTTACCGTCGTCCAATGACGGGGCCTTTTCGCCTTCGCCCCTCTTCTTCTCCCATACG
CCCCCGAGGCCGCTCGGCCGCCCGACGAACTCGGCTCCTCCGGACGTGACGGCCGGCATGCTGTCCCGCGCACGT
GATGACGCGGCCGCTATCACCACCGTCAAGCTTCCTCGCGGCAGCGTCTGCTCTAGTCCAGCCATGACGGGCAGC
AGCATGAGTTCCTCGCTCGACTTGTCGCTTCCCACACTGAGCCCCGATGGTCGCAGCCTACCCGCCAGCTTGCAA
AAGGTTCAGAGCATCGGCGCCATCGAGTTCGTCGAGCACGACGAGAGACCGACCTTTCTCGTCGATCTGTCTAAC
CCACCGGATGTGAAACAGTCGGGGCTGAACATACTGTATTACAACGGCGCCCTGCGATCTTGTGCCGACATGTAC
GCCTTGCTCTCCGCCGACAACCAAAATACCACAACTCAAGCCTTTGATCGTTTCAAGGCCTGGGCCTACCACCCT
CATATCAGCGATTCCTCCGTTCCGTTCCCTACCCATCGTCACTATGGTGGCACCGACTGGACCTCTACGACGTTG
CGCCAGAGGTTCCGCTTCATCAGCGCCAACTCCACGGCTCACGCCTCTCGGCCTCGCCTCTCTCGGCCTTCTTCT
GTCGAATCGGTTCCTTCTGCTGTGGCCGAATCTCCTCTCGGCCAGTCAATGCCAATCACTCCAGAAGGGGATAAC
TCGGACCTTCCAGACTACTTCGGCGATGCTGCCACCGCGGCCCTTAAGCCTGGCCTTGCCCCGACGCTCAACGAT
ATCCAAACCGAGACAAAGTATAGCGACGATCGCCGGCATCCGGACGACTTTACCAACCAGGTGCTGCAGCTGCAA
CCTACTAAATCCGTGTTCGACTGGACCAGGATACCCATCACCGACACCCTCCCCGAGCACATCAAGTTTGCCAAG
TCGGTCGATTGGGCCTCGACGCCCCTGGGACCAATGTCGGAATGGACGAGCGACCTGAGAGCCATGTCGAACCTG
ATTATGGGCAGCCCTCATCCTGCCGCCATGTACTGGGGTCCCGATTTGATTTGCATATACAACGCCGCATATATC
GAGCTTGCCGGGCAAAAGCATCCGTCGCTCATGGGCATGTCGTATAAAGACGGCTGGTCTGAGATCTGGAGCGAG
ATTGAGCCGATATTCAAGAGTGCGACGGAATGCGGTCAGGCCATGATGAAACACGATAACCGACTCTTCCTCCAT
CGTCACGGCTTCCTCGAGGAGACGTTCTTCTCCTGGGCCATCGTACCCCTGGTCGGGAACGAGGGCGAGGTGGTT
GGACTGTACAATCCAGCCTTCGAGCACACGCTACGTCGAATCAACGACCGTCGGATGCTGACGCTGCGAGAGATT
GGGGAGAGGACAGCTGCGGCGACGACGGTGAGCGGCTTCTGGCCCCAGGTGCAGAAGGGCCTCGAGTACAATGAG
AACGACGTCCCGTTCAGCCTCATCTACTCAATCAAGGAGGAAGCGGAGAGCGAGGTGTCGTCTCTACAATCGGGC
AGCTTCATGCACTCACCGCAAGTCGCGCTCGAGGGCTCACCCGGCGTGCCCGAGGGGCATGCTGCCGCTCCCCCT
TATCTGGACTTGAGGACGTCGGACGAAGGCTTCGCGCCGTATATGCGGCAGTGTATGCAAGGGGGCAGCGAGCCG
TTGGTCCTGTCTGCGAGCGACGACTCCCTTCCGAAGCACCTCGTCGAGGGCATCGAAGGACGGGGCTTTGGCGAT
GCTTGCACCAACGTCGTCATCTTTCCCGTCGTACCAACGACTAAAGAGGCAGCCACCGGCTTCATTGTGCTCGGT
CTGAACCCTCGGCGACCGTACGACGATAACTACAAGCTCTTCATCCACCTTCTCTCTCGGCAGTTGGCGACGTCG
ATGGCTTCGGTGGTGCTCTTCGAAGAAGAGATTCGTCGAGGCCAGCGGGCGGCGCGACTGGCGGCTCTGGATCGC
CAGGAGCTGTCGATGCAGCTCTTGTTGCGGACGCAGGAAGCCAACGAGAGCGAGTATCGGTTCACGCGCATGGCC
GAGTACGCGCCGGTGGGCATGTTCATCGCCGACTGCCACGGTCGCATCACCTACTGCAACGATATGTGGTGGCAG
ATCTCGCGTCACTCCCGTTTCGACGAGACGGAGCTCGCGTGGATGAACAGCGTCAGAGATGAGGACAGACCGCCG
CTGGAGGAGGCGTGGCGGAAGCTGCTCAGGGACCGCGTCACCATCTCGGTCGAGTTCCGCTTCAATCACAGCCAG
CAGAGTGGCGTCAACACCATCGACACCTGGGTACTCATGAGCGCCTTTCCCGAAAAGAATGCCGACGGCGTGCTC
AAGTCCATCTTTGGCTGTATCACCGACATCTCGTCCCAGAAGTGGGCCGAGAAGGTACAGAGCGAGAGGAGGGAA
GAGGCCGTTGAGCTCAAGCGTCAGCAGGAGAACTTCATTGACATCACCAGCCACGAGATGCGAAACCCGCTTTCG
GCCATCTTGCAGTGCGCCGATCAAGTATCCAACAACATTGTCACCTTTTCCGCCCACAAGGATCCGGCCCAGCTG
GAGACGTTCCTCGAGAGCTGCCTGGACGCGGCCAACACCATCAATCTCTGTGCCAGTCACCAGAAACGCATTGTC
GACGACATCCTCACCCTGTCCAAGCTCGACTCTAACCTCTTGGCCGTCACTCCGGTCGACGAGCAGCCGGTCAAG
GCGGTGCAGCGCGCGCTCAAGATGTTCGAATCGGAGCTGCAGGCCCACGACATTGAGCTCGAGTTCAGCGCCGAT
GACAGCTTCGAGAGGCACGGCGTCGAATGGGCCAAGCTCGATCCGTCGAGGCTGCGGCAGGTCCTGATTAACCTG
ATGACCAACGCCATCAAGTTCACTCAGGGCCGCGACAAGCGTAAGATCGTCGTCTCCCTGTCGGCGTCCAAGGAC
ATTTCCGAGGTGACCAGCCAGGGTGTTCTCTACTTTGACCGCAACGGCGGCCCCCGCATGACGGGCATGGATATC
GACAACGAGGCAGACTGGGGCGCTGGTGAACGCATCAACATACACTGCTCGGTAGAGGACACGGGGCCCGGGCTG
GCCGAAGAGGAGCTCAAGGTGCTGTTTCAGCGTTTCCAACAGGCGACGCCCCGCACGCACGTCAAGTACGGCGGC
TCCGGCTTGGGGCTGTTCATCTCGAGGATTCTAACCGAGATGCAGGGCGGGCAGATTGGCGTCACGTCGGCCAGG
GGCAAGGGCAGCAAGTTTAACTTTTACATCCAGAGCCGCAAGAGTCTGGACCCTCCATCAAGCTACGAACCCATA
TCGCCCTTCCGGATCGGCCGGAAGACGCAGGCTCTGGCAGCGGCCTCGCCGAGCAGCACCCAGTCCGCCCGCAGC
GCCACGGGCAAAGACGGGCAGCCGCTGTTCGACGTGCTCATCGTCGAGGACAACATCGTCAACCAAAAGGTGCTT
CAGAGGCAGCTGCGCAGCTGGGGAAACAACACGTTTGTGGCCAATCACGGGCGCGAGGCTCTCCAGACGCTGGAG
AAGTCGAGGTTCTGGGCCGGGCAGGAGGCCGAGGGCGTCGACATCTCCGTCATTCTCATGGACTTGGAGATGCCC
GTCATGGACGGAATGACGTGCGCTCGGCGGATCCGTGAGCTCGAGAGGGAGGGTACGATTGTGAAGCACATACCC
ATCATTGCCGTCACGGCCTATGCGCGTCCCGAGCAGATTGAGGACGCCAAGGCCGCTGGTATCGTGAGTTTCCCT
GCCTCATACATTATACATGCGTGAGGAAGGCTACTGACACGAGAGGCAGGACGACGTCATCTCGAAGCCGTTCCG
CATCCCGGAGCTGATGCCCAAGATTGAGGAGCTGGTAGGCAGGTGGCGGAACCTGGCCGTACCAGCCGGAGCGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail