Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02272
Gene name
Locationscaffold_02:3103276..3108000
Strand-
Gene length (bp)4724
Transcript length (bp)3549
Coding sequence length (bp)3549
Protein length (aa) 1183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00041 fn3 Fibronectin type III domain 2.1E-08 188 256

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.37 0.3475 0.1182 0.2585 0.1498 0.0333 0.6366 0.2991 0.3429 0.1924

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1991
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|4379
Ophiocordyceps camponoti-floridani Ophcf2|02272 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3175
Ophiocordyceps kimflemingae Ophio5|5107
Ophiocordyceps subramaniannii Hirsu2|221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02272
MVLHYASWSARFGVDVVPVPSPSPGAAVFYCAARGKLLSSKQPPNNKWLLQGAEFHLSQIKTSRAGPRHVPLTWT
GLDEMAGRQRRSNSPLLPGQTAWHRQGPRSSASVHAQVGLVGLALLIDCRRQALRLCEAAVHASFDAAPLQQLRM
ALILGSVVWLLHRSWQTLWKPVPELVSILGVDIPQAPDVCLAGISADSATLSWSRSASHRPVQKYLIQVNGVHVG
ESPGNETAITVTGLRPNHFYNLRVVAVGSNTFRAGSPFIRLRTFGKDGRPQLGDSRLPTSFVDPDHPRCEHVDEK
DKHEGLVSSLPMVEAAPVLESSAVLPRDSGVVLSQRRNTVNRRQSPSVAGLDQPPARPLEPELSLTELTDKFEGI
RKEIDDTVALHVKDLAESHNQELELRRDVERKRLILKEKEENTAQLKSEMRFTMETMRAAEKDRAKQEQRLKEKE
SKKGVIRESIVKFQTDTERMKKERQSFENHKRELAKEHDHDIRKLDSENTTLQNECNQLEADLRDKGKQLQDFKT
AKEQQSGLDDERWREESSRLKRDWDHHKRDLHNRLAAETKEGQLLSPQIRDLTEQLKVQQATGLAFCGQPGPSAV
DYDPSPASQPARMVHNGNPLLKAVLPSPDRVPLADSNLQAAVGFSNAGFMPRLFMDPATDGINEIESKVSGETLS
PSAQTLLPSNIFEESEDADGIGSRTFFMLNQRPPKPAAEEGPQSPASSNMSFNVFSSPHGSAHNLAFPQYPENGE
AKSLNAGSSPSETPTTGHKLASFLSTLQRGRAAKCSDGGGPPIGSLKPAQSQSFPSAADEDAIGSRRRINIGSWV
VRDSDTSDRARPPSATPIGTSRPLSAMRPNPHKGSDREDELSRPASIASMDLPRPSTDSGSIWGAPGDSMALHKN
RLWPRGEGPWPSRSGSRRPSLQGATAPTTTLASADDEILGEDELLNPETLPSQIGVIGSRPPAAVRTMSQRLNPA
APTFMAHIFRKDKDKDKGKAKEVATSAGDLATGLDRSPSGSWRSHDGHSIHTQVSTSESRESLQLDSTISNAASD
LQTPSASSLKDPDKAVRKLFRKGSSSKFSLSTRLGKDSSLFKKGSGSSANSDRNTPGEHRSSIGDGDDVGDDGAM
LGRSFDSMASSSSLGPSKSKEGRETGRISSWRFSMSSIKKKGRDTPVKDAEQTPEDG*
Coding >Ophcf2|02272
ATGGTACTCCACTACGCCAGCTGGTCGGCCCGTTTCGGCGTCGACGTTGTTCCCGTCCCTTCGCCGTCGCCGGGG
GCCGCCGTCTTCTACTGTGCGGCCCGAGGCAAGCTGCTCTCAAGCAAGCAGCCGCCAAACAACAAATGGCTGCTT
CAAGGCGCGGAATTCCATCTCAGTCAAATCAAGACTTCGCGCGCGGGACCGCGACACGTGCCGCTGACTTGGACC
GGTCTCGATGAGATGGCGGGTCGACAGCGCAGATCTAATTCTCCGCTGCTCCCGGGACAGACGGCCTGGCATCGG
CAAGGGCCCCGGTCATCGGCGTCCGTTCACGCCCAAGTCGGCCTCGTCGGCCTCGCTCTTCTCATCGACTGCCGC
AGGCAGGCCCTGCGCCTGTGCGAGGCCGCCGTCCACGCCTCATTCGATGCCGCACCTCTTCAGCAGTTGAGAATG
GCCCTGATACTCGGGTCTGTTGTCTGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAGAGCTG
GTCAGCATCCTCGGAGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCAGCGCCGACTCAGCTACG
CTCAGCTGGTCTCGGTCTGCGTCCCACAGGCCAGTGCAAAAGTATCTGATTCAAGTAAACGGCGTTCACGTCGGG
GAATCCCCGGGCAATGAAACTGCCATCACCGTCACCGGCCTGCGTCCGAATCACTTCTACAATTTGCGCGTCGTC
GCCGTAGGCTCCAACACCTTTCGCGCCGGGAGTCCATTCATCCGCCTTCGAACGTTTGGTAAGGACGGCAGACCG
CAGCTGGGCGACTCGCGCCTGCCCACCAGCTTCGTCGATCCCGATCACCCCCGCTGCGAACATGTCGACGAAAAA
GACAAACACGAAGGGCTTGTCTCCTCGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCTTG
CCCAGGGATTCTGGAGTCGTCCTCAGCCAACGCCGAAATACCGTCAACCGTCGGCAATCGCCCTCTGTTGCTGGC
TTGGATCAGCCTCCTGCAAGGCCGTTGGAGCCTGAATTGTCTCTGACCGAACTCACCGACAAGTTCGAGGGGATT
AGAAAGGAAATCGACGACACCGTGGCTCTCCATGTCAAGGATTTGGCCGAGTCTCATAACCAGGAGTTGGAACTC
AGGAGAGATGTGGAACGCAAGCGACTGATTCTCAAAGAAAAGGAAGAAAACACGGCTCAGCTCAAAAGCGAGATG
CGCTTCACCATGGAGACGATGCGAGCCGCCGAGAAAGATCGGGCAAAACAGGAGCAGCGGCTCAAGGAAAAAGAG
TCGAAAAAGGGCGTGATTCGCGAAAGCATCGTCAAGTTCCAAACGGACACGGAAAGAATGAAAAAGGAGCGCCAA
AGCTTCGAGAATCATAAGAGAGAGCTAGCGAAGGAGCATGACCACGACATTCGCAAGCTCGACAGCGAAAACACG
ACCTTACAGAACGAGTGCAACCAGCTCGAGGCCGATCTCAGGGACAAGGGCAAGCAGCTGCAGGATTTCAAGACG
GCCAAGGAGCAGCAGTCGGGACTCGATGACGAGAGGTGGCGGGAAGAGAGTTCTAGGCTTAAGAGGGACTGGGAT
CATCATAAGAGAGATCTGCACAACCGCCTCGCTGCCGAGACAAAAGAGGGACAGCTTTTGAGTCCGCAGATTCGA
GACCTCACGGAGCAACTGAAAGTTCAGCAGGCGACAGGTCTCGCCTTTTGCGGCCAGCCTGGCCCTTCAGCCGTC
GACTACGATCCTTCGCCAGCTTCCCAGCCGGCGCGAATGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCTTG
CCGTCGCCTGACCGGGTCCCCTTGGCAGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAATGCGGGCTTCATG
CCGCGACTGTTCATGGACCCGGCGACTGACGGCATCAACGAGATCGAGTCCAAGGTCTCCGGTGAAACGCTGAGC
CCTTCGGCACAGACTCTCCTGCCGTCCAATATCTTTGAGGAGAGCGAAGATGCGGACGGCATCGGATCTAGGACT
TTCTTCATGCTAAACCAAAGGCCTCCCAAACCCGCGGCCGAGGAGGGCCCCCAGTCTCCGGCCTCGTCCAACATG
TCCTTCAACGTCTTCTCAAGCCCGCATGGGTCCGCCCACAACCTCGCTTTCCCACAGTATCCCGAGAACGGCGAG
GCAAAGTCGCTCAACGCAGGATCCTCGCCGTCAGAGACGCCGACCACCGGCCACAAGCTTGCCAGCTTCCTCTCG
ACCTTGCAACGGGGCCGGGCGGCCAAGTGCTCCGATGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAG
AGCCAGTCTTTCCCCTCGGCGGCTGATGAGGATGCCATAGGAAGCCGGCGAAGGATCAACATTGGCTCGTGGGTC
GTTCGCGATTCGGATACGTCGGACAGAGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGGCCGCTATCG
GCCATGCGTCCCAACCCGCACAAGGGCTCCGACCGGGAGGACGAGCTTTCGCGTCCCGCGTCGATTGCGTCGATG
GACCTGCCGCGTCCTTCTACCGACAGCGGATCTATCTGGGGCGCTCCTGGAGACTCGATGGCGCTGCACAAGAAC
AGGCTCTGGCCCAGGGGAGAAGGCCCGTGGCCCTCTCGGAGCGGATCCAGGAGGCCGTCTCTACAGGGCGCCACG
GCGCCGACCACCACGCTCGCCTCTGCCGATGACGAGATTCTGGGCGAAGACGAGCTCCTGAACCCGGAGACGCTA
CCGAGCCAGATCGGTGTGATTGGGTCTCGTCCACCGGCCGCCGTGAGGACTATGAGTCAACGCCTCAACCCAGCA
GCCCCGACCTTCATGGCCCACATCTTTCGAAAGGACAAGGACAAGGACAAGGGTAAGGCAAAGGAGGTTGCGACC
TCGGCTGGTGACTTGGCGACGGGGTTGGACCGCTCACCCTCGGGGTCGTGGCGGTCGCACGACGGGCACTCGATA
CACACGCAGGTTTCCACGTCCGAGTCTCGCGAGTCGTTGCAGCTCGACTCGACCATCTCCAACGCGGCTTCGGAT
CTGCAAACACCCTCGGCATCGAGCCTGAAGGACCCGGATAAGGCTGTCAGGAAGCTTTTCCGCAAGGGCAGCTCG
AGCAAGTTTAGTCTGTCGACGAGGCTGGGGAAGGACTCGAGCCTGTTTAAGAAGGGGTCTGGCAGCAGCGCAAAC
TCGGACAGGAACACGCCGGGCGAACACCGCTCTAGCATCGGCGACGGGGACGACGTCGGAGACGATGGCGCCATG
CTGGGACGAAGCTTCGATAGTATGGCGAGCAGCTCGTCACTCGGTCCGTCAAAGTCCAAGGAAGGTCGAGAAACA
GGTAGGATTAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAAAAGGGCAGAGACACGCCGGTCAAGGACGCG
GAACAGACGCCGGAAGACGGCTAA
Transcript >Ophcf2|02272
ATGGTACTCCACTACGCCAGCTGGTCGGCCCGTTTCGGCGTCGACGTTGTTCCCGTCCCTTCGCCGTCGCCGGGG
GCCGCCGTCTTCTACTGTGCGGCCCGAGGCAAGCTGCTCTCAAGCAAGCAGCCGCCAAACAACAAATGGCTGCTT
CAAGGCGCGGAATTCCATCTCAGTCAAATCAAGACTTCGCGCGCGGGACCGCGACACGTGCCGCTGACTTGGACC
GGTCTCGATGAGATGGCGGGTCGACAGCGCAGATCTAATTCTCCGCTGCTCCCGGGACAGACGGCCTGGCATCGG
CAAGGGCCCCGGTCATCGGCGTCCGTTCACGCCCAAGTCGGCCTCGTCGGCCTCGCTCTTCTCATCGACTGCCGC
AGGCAGGCCCTGCGCCTGTGCGAGGCCGCCGTCCACGCCTCATTCGATGCCGCACCTCTTCAGCAGTTGAGAATG
GCCCTGATACTCGGGTCTGTTGTCTGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAGAGCTG
GTCAGCATCCTCGGAGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCAGCGCCGACTCAGCTACG
CTCAGCTGGTCTCGGTCTGCGTCCCACAGGCCAGTGCAAAAGTATCTGATTCAAGTAAACGGCGTTCACGTCGGG
GAATCCCCGGGCAATGAAACTGCCATCACCGTCACCGGCCTGCGTCCGAATCACTTCTACAATTTGCGCGTCGTC
GCCGTAGGCTCCAACACCTTTCGCGCCGGGAGTCCATTCATCCGCCTTCGAACGTTTGGTAAGGACGGCAGACCG
CAGCTGGGCGACTCGCGCCTGCCCACCAGCTTCGTCGATCCCGATCACCCCCGCTGCGAACATGTCGACGAAAAA
GACAAACACGAAGGGCTTGTCTCCTCGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCTTG
CCCAGGGATTCTGGAGTCGTCCTCAGCCAACGCCGAAATACCGTCAACCGTCGGCAATCGCCCTCTGTTGCTGGC
TTGGATCAGCCTCCTGCAAGGCCGTTGGAGCCTGAATTGTCTCTGACCGAACTCACCGACAAGTTCGAGGGGATT
AGAAAGGAAATCGACGACACCGTGGCTCTCCATGTCAAGGATTTGGCCGAGTCTCATAACCAGGAGTTGGAACTC
AGGAGAGATGTGGAACGCAAGCGACTGATTCTCAAAGAAAAGGAAGAAAACACGGCTCAGCTCAAAAGCGAGATG
CGCTTCACCATGGAGACGATGCGAGCCGCCGAGAAAGATCGGGCAAAACAGGAGCAGCGGCTCAAGGAAAAAGAG
TCGAAAAAGGGCGTGATTCGCGAAAGCATCGTCAAGTTCCAAACGGACACGGAAAGAATGAAAAAGGAGCGCCAA
AGCTTCGAGAATCATAAGAGAGAGCTAGCGAAGGAGCATGACCACGACATTCGCAAGCTCGACAGCGAAAACACG
ACCTTACAGAACGAGTGCAACCAGCTCGAGGCCGATCTCAGGGACAAGGGCAAGCAGCTGCAGGATTTCAAGACG
GCCAAGGAGCAGCAGTCGGGACTCGATGACGAGAGGTGGCGGGAAGAGAGTTCTAGGCTTAAGAGGGACTGGGAT
CATCATAAGAGAGATCTGCACAACCGCCTCGCTGCCGAGACAAAAGAGGGACAGCTTTTGAGTCCGCAGATTCGA
GACCTCACGGAGCAACTGAAAGTTCAGCAGGCGACAGGTCTCGCCTTTTGCGGCCAGCCTGGCCCTTCAGCCGTC
GACTACGATCCTTCGCCAGCTTCCCAGCCGGCGCGAATGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCTTG
CCGTCGCCTGACCGGGTCCCCTTGGCAGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAATGCGGGCTTCATG
CCGCGACTGTTCATGGACCCGGCGACTGACGGCATCAACGAGATCGAGTCCAAGGTCTCCGGTGAAACGCTGAGC
CCTTCGGCACAGACTCTCCTGCCGTCCAATATCTTTGAGGAGAGCGAAGATGCGGACGGCATCGGATCTAGGACT
TTCTTCATGCTAAACCAAAGGCCTCCCAAACCCGCGGCCGAGGAGGGCCCCCAGTCTCCGGCCTCGTCCAACATG
TCCTTCAACGTCTTCTCAAGCCCGCATGGGTCCGCCCACAACCTCGCTTTCCCACAGTATCCCGAGAACGGCGAG
GCAAAGTCGCTCAACGCAGGATCCTCGCCGTCAGAGACGCCGACCACCGGCCACAAGCTTGCCAGCTTCCTCTCG
ACCTTGCAACGGGGCCGGGCGGCCAAGTGCTCCGATGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAG
AGCCAGTCTTTCCCCTCGGCGGCTGATGAGGATGCCATAGGAAGCCGGCGAAGGATCAACATTGGCTCGTGGGTC
GTTCGCGATTCGGATACGTCGGACAGAGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGGCCGCTATCG
GCCATGCGTCCCAACCCGCACAAGGGCTCCGACCGGGAGGACGAGCTTTCGCGTCCCGCGTCGATTGCGTCGATG
GACCTGCCGCGTCCTTCTACCGACAGCGGATCTATCTGGGGCGCTCCTGGAGACTCGATGGCGCTGCACAAGAAC
AGGCTCTGGCCCAGGGGAGAAGGCCCGTGGCCCTCTCGGAGCGGATCCAGGAGGCCGTCTCTACAGGGCGCCACG
GCGCCGACCACCACGCTCGCCTCTGCCGATGACGAGATTCTGGGCGAAGACGAGCTCCTGAACCCGGAGACGCTA
CCGAGCCAGATCGGTGTGATTGGGTCTCGTCCACCGGCCGCCGTGAGGACTATGAGTCAACGCCTCAACCCAGCA
GCCCCGACCTTCATGGCCCACATCTTTCGAAAGGACAAGGACAAGGACAAGGGTAAGGCAAAGGAGGTTGCGACC
TCGGCTGGTGACTTGGCGACGGGGTTGGACCGCTCACCCTCGGGGTCGTGGCGGTCGCACGACGGGCACTCGATA
CACACGCAGGTTTCCACGTCCGAGTCTCGCGAGTCGTTGCAGCTCGACTCGACCATCTCCAACGCGGCTTCGGAT
CTGCAAACACCCTCGGCATCGAGCCTGAAGGACCCGGATAAGGCTGTCAGGAAGCTTTTCCGCAAGGGCAGCTCG
AGCAAGTTTAGTCTGTCGACGAGGCTGGGGAAGGACTCGAGCCTGTTTAAGAAGGGGTCTGGCAGCAGCGCAAAC
TCGGACAGGAACACGCCGGGCGAACACCGCTCTAGCATCGGCGACGGGGACGACGTCGGAGACGATGGCGCCATG
CTGGGACGAAGCTTCGATAGTATGGCGAGCAGCTCGTCACTCGGTCCGTCAAAGTCCAAGGAAGGTCGAGAAACA
GGTAGGATTAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAAAAGGGCAGAGACACGCCGGTCAAGGACGCG
GAACAGACGCCGGAAGACGGCTAA
Gene >Ophcf2|02272
ATGGTACTCCACTACGCCAGCTGGTCGGCCCGTTTCGGCGTCGACGTTGTTCCCGTCCCTTCGCCGTCGCCGGGG
GCCGCCGTCTTCTACTGTGCGGCCCGAGGCAAGCTGCTCTCAAGCAAGCAGCCGCCAAACAACAAATGGCTGCTT
CAAGGCGCGGAATTCCATCTCAGTCAAATCAAGACTTCGCGCGCGGGACCGCGACACGTGCCGCTGACTTGGACC
GGTCTCGATGAGATGGCGGGTCGACAGCGCAGATCTAATTCTCCGCTGCTCCCGGGACAGACGGCCTGGCATCGG
CAAGGGCCCCGGTCATCGGCGTTCGGACCCGTGCGTTGGACTCGAAGCCACAACCTTGTTGAGAAGCAGAGGGAA
GCTCGGCAGCCAAGGGACGCATCCATTGACGACAACAAGCGAGAGACAAAGAAGAATTTGACGGCGCGTGCCTCG
TATGTACATATGGAAGTGCGAGAAACGGCCGAGGTCCAATGCCACTCGCGTCGCCTAGGTAAGTTCTACATAGGT
ACAAGCATACATTCGTACATACCTAGTTTCGAGCAACGAAACAGAGACAAGGCTTTATAAGCGCCTTACGCATGT
TGGCAAGGCGCCTGATCAACGTGTTGGACACGCCATAAAGAGGGTCTTCCCGCAGAGCAAATCGCAAGACGGAAA
ATGCGCATAACGAGTAGAATCAAGTCCTCATGCGGTCTCCCTCCACCGCGATTTTTTCACCTGCTCGTCAACGCA
GACTTAGCAGGTGTCTGCGTATGTATGTATGTACAGTCTTCCTCTACCTACAGTCTGCCTACAGTCTACGGCCAG
TCTACAACGACACCGATTATTGGACTCCACCGTTACACGACAGCCTCCGTTCGTAGCTTCAACAACTAAGTGCCA
GGAGGAGCATTAAAGTGTGCGGATGTCTACCCCCTTCAGACTTTTCCTTCTCGTATCCTCCCGCACCGTTGCACG
CGCTTCGATACCTCTTTCCATCGCCGCTCTCATGTACCTGCCTCGACCGTTGGCCCCAGCCACAGCCTCACCAGC
CAATCAGGCTCGCCGTCAGCGCCTCATCCATCCTTGCGCCTTGCCATCCACGTCTCCTCCTTGCCGGAGACCACC
ATCATTTTGCTCTCTCTCTCGCCCTGTCGCCGTCCCGACAGCGCTCCGAGGGCTGAGAACATGTTATGGGCGCTT
CCGACCCTGACCGCCGCTTGCCTCGCCCTCTGCAGCCTCTACCACTTCTTTAGCCGCCATATAGCCAGCCCCAGG
TCCGTTCACGCCCAAGTCGGCCTCGTCGGCCTCGCTCTTCTCATCGACTGCCGCAGGCAGGCCCTGCGCCTGTGC
GAGGCCGCCGTCCACGCCTCATTCGATGCCGCACCTCTTCAGCAGTTGAGAATGGCCCTGATACTCGGGTCTGTT
GTCTGGTGAGTTTCCCTGTCCGCCTCTCCGTGTTGGAAGCATCGACTTTTTTTTTCTACGCACGCCTAGGGGAGA
ATTTCGCGCTTCTTCCCATCTGCGATGCAATCAAACGCTTCTCTTGTCCAGATGACGCCAATATTTCTGACGCCA
GTGCTTTGATAGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAGAGCTGGTCAGCATCCTCGG
AGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCAGCGCCGACTCAGCTACGCTCAGCTGGTCTCG
GTCTGCGTCCCACAGGCCAGTGCAAAAGTATCTGATTCAAGTAAACGGCGTTCACGGTCAGTTCCCCCACCTCGG
GAAGGCTCTTGACCCTTTCCACGGCTGACCCGCGTATTCTCATAGTCGGGGAATCCCCGGGCAATGAAACTGCCA
TCACCGTCACCGGCCTGCGTCCGAATCACTTCTACAATTTGCGCGTCGTCGCCGTAGGCTCCAACACCTTTCGCG
CCGGGAGTCCATTCATCCGCCTTCGAACGTTTGGTAAGGACGGCAGACCGCAGCTGGGCGACTCGCGCCTGCCCA
CCAGCTTCGTCGATCCCGATCACCCCCGCTGCGAACATGTCGACGAAAAAGACAAACACGAAGGGCTTGTCTCCT
CGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCTTGCCCAGGGATTCTGGAGTCGTCCTCA
GCCAACGCCGAAATACCGTCAACCGTCGGCAATCGCCCTCTGTTGCTGGCTTGGATCAGCCTCCTGCAAGGCCGT
TGGAGCCTGAATTGTCTCTGACCGAACTCACCGACAAGTTCGAGGGGATTAGAAAGGAAATCGACGACACCGTGG
CTCTCCATGTCAAGGATTTGGCCGAGTCTCATAACCAGGAGTTGGAACTCAGGAGAGATGTGGAACGCAAGCGAC
TGATTCTCAAAGAAAAGGAAGAAAACACGGCTCAGCTCAAAAGCGAGATGCGCTTCACCATGGAGACGATGCGAG
CCGCCGAGAAAGATCGGGCAAAACAGGAGCAGCGGCTCAAGGAAAAAGAGTCGAAAAAGGGCGTGATTCGCGAAA
GCATCGTCAAGTTCCAAACGGACACGGAAAGAATGAAAAAGGAGCGCCAAAGCTTCGAGAATCATAAGAGAGAGC
TAGCGAAGGAGCATGACCACGACATTCGCAAGCTCGACAGCGAAAACACGACCTTACAGAACGAGTGCAACCAGC
TCGAGGCCGATCTCAGGGACAAGGGCAAGCAGCTGCAGGATTTCAAGACGGCCAAGGAGCAGCAGTCGGGACTCG
ATGACGAGAGGTGGCGGGAAGAGAGTTCTAGGCTTAAGAGGGACTGGGATCATCATAAGAGAGATCTGCACAACC
GCCTCGCTGCCGAGACAAAAGAGGGACAGCTTTTGAGTCCGCAGATTCGAGACCTCACGGAGCAACTGAAAGTTC
AGCAGGCGACAGGTCTCGCCTTTTGCGGCCAGCCTGGCCCTTCAGCCGTCGACTACGATCCTTCGCCAGCTTCCC
AGCCGGCGCGAATGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCTTGCCGTCGCCTGACCGGGTCCCCTTGG
CAGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAATGCGGGCTTCATGCCGCGACTGTTCATGGACCCGGCGA
CTGACGGCATCAACGAGATCGAGTCCAAGGTCTCCGGTGAAACGCTGAGCCCTTCGGCACAGACTCTCCTGCCGT
CCAATATCTTTGAGGAGAGCGAAGATGCGGACGGCATCGGATCTAGGACTTTCTTCATGCTAAACCAAAGGCCTC
CCAAACCCGCGGCCGAGGAGGGCCCCCAGTCTCCGGCCTCGTCCAACATGTCCTTCAACGTCTTCTCAAGCCCGC
ATGGGTCCGCCCACAACCTCGCTTTCCCACAGTATCCCGAGAACGGCGAGGCAAAGTCGCTCAACGCAGGATCCT
CGCCGTCAGAGACGCCGACCACCGGCCACAAGCTTGCCAGCTTCCTCTCGACCTTGCAACGGGGCCGGGCGGCCA
AGTGCTCCGATGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAGAGCCAGTCTTTCCCCTCGGCGGCTG
ATGAGGATGCCATAGGAAGCCGGCGAAGGATCAACATTGGCTCGTGGGTCGTTCGCGATTCGGATACGTCGGACA
GAGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGGCCGCTATCGGCCATGCGTCCCAACCCGCACAAGG
GCTCCGACCGGGAGGACGAGCTTTCGCGTCCCGCGTCGATTGCGTCGATGGACCTGCCGCGTCCTTCTACCGACA
GCGGATCTATCTGGGGCGCTCCTGGAGACTCGATGGCGCTGCACAAGAACAGGCTCTGGCCCAGGGGAGAAGGCC
CGTGGCCCTCTCGGAGCGGATCCAGGAGGCCGTCTCTACAGGGCGCCACGGCGCCGACCACCACGCTCGCCTCTG
CCGATGACGAGATTCTGGGCGAAGACGAGCTCCTGAACCCGGAGACGCTACCGAGCCAGATCGGTGTGATTGGGT
CTCGTCCACCGGCCGCCGTGAGGACTATGAGTCAACGCCTCAACCCAGCAGCCCCGACCTTCATGGCCCACATCT
TTCGAAAGGACAAGGACAAGGACAAGGGTAAGGCAAAGGAGGTTGCGACCTCGGCTGGTGACTTGGCGACGGGGT
TGGACCGCTCACCCTCGGGGTCGTGGCGGTCGCACGACGGGCACTCGATACACACGCAGGTTTCCACGTCCGAGT
CTCGCGAGTCGTTGCAGCTCGACTCGACCATCTCCAACGCGGCTTCGGATCTGCAAACACCCTCGGCATCGAGCC
TGAAGGACCCGGATAAGGCTGTCAGGAAGCTTTTCCGCAAGGGCAGCTCGAGCAAGTTTAGTCTGTCGACGAGGC
TGGGGAAGGACTCGAGCCTGTTTAAGAAGGGGTCTGGCAGCAGCGCAAACTCGGACAGGAACACGCCGGGCGAAC
ACCGCTCTAGCATCGGCGACGGGGACGACGTCGGAGACGATGGCGCCATGCTGGGACGAAGCTTCGATAGTATGG
CGAGCAGCTCGTCACTCGGTCCGTCAAAGTCCAAGGAAGGTCGAGAAACAGGTAGGATTAGCAGCTGGCGCTTCT
CCATGTCGTCAATTAAGAAAAAGGGCAGAGACACGCCGGTCAAGGACGCGGAACAGACGCCGGAAGACGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail