Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02265
Gene name
Locationscaffold_02:3084434..3089227
Strand+
Gene length (bp)4793
Transcript length (bp)4674
Coding sequence length (bp)4674
Protein length (aa) 1558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12816 Vps8 Golgi CORVET complex core vacuolar protein 8 3.2E-68 699 899

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.4501 0.5253 0.1469 0.0182 0.1208 0.0257 0.095 0.4513 0.2813 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3814
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|778
Ophiocordyceps australis map64 (Brazil) OphauB2|4399
Ophiocordyceps camponoti-floridani Ophcf2|02265 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3093
Ophiocordyceps kimflemingae Ophio5|5876
Ophiocordyceps subramaniannii Hirsu2|7481

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02265
MSDPQDTSPARDEEACELDADVLHMEPQQDRAMTPEASLRPLAGPRRRSGSLLSSADVSLSLMEGLPRRAGSPVD
SLASGVGKTPSLQGSLMSSPGSSVLPTTASRPGLGSPTPSFRPFDRRFHSRYSPSPTSTPRGSSPAFASGHSRNV
SFMSNFPLDQADTDTPSAPWDVVRWTRLKKLNNSAFSELGRRNFGSPTCVAVSTSIVLGTSKGIILMFDYHQNIK
MIIGQGTQAVESGPVTSIAVSSDHSTIAGGHANGNIFTWDTSRAARPFLSIPHLHESRVQDRSADGHIPNVSVVH
LGFLGTRHTALVSADDRGMAFSHLATRGTGALGRTVKTTRILGRYPGAPIPAGKPLKPSTVLAFAPLPLGNVERA
TDTMGLTAMLTPYLLVVVSTTPVARTQHKSARPKEVPAHAAMTGCLAWFPAVKLKVPDPASGSDVSKVKLVYCWS
NVLTVLDVDETPSEDPDQPSSLKFKARSRWKCEEAIVAVQWLTRSVLTVLTISQRLIVLEDGTLRMTEALDLLQK
HIYHTDLFSKQLHMLVEQLDNEDDSMHGVVADAFYMSFKAYKGRIFLLGFSEVSIGALANWADRLIAMMEHGDYV
GAIRLATSYYAGDADKLTIGLPEDAQLRHTMVRDKIVEIMAASLKYAFGQRLRNSDSADDDQLRRLAEACFAACQ
AIDTTDYLFDEVYERYEAAAATGIFHETLEPYVLDESITSVPPAVVKDLVAYYVSCGWEGRLEELICRMQTATFD
LDRITTLCKENGLYDALIYVWNQALGDYISPMMDLLSLLVPLTANGQHGAVASEDYYGVNALKIFPYLSYILTSR
AYPSGDLMDDGTASRAKSEIYWFFFSGKTIEWPRGSGRELLTRPPGEAEPAFPYLWMVLKFDAPSFLSALNEAFE
DSFLNDSPDRRVNGGAGADMPEEQVFSLAINRQYIVAILVDVMGPDKFSPEDTIYLDMFIARNLPKFPQYLLFSG
STLSRVLSNLCSYPGEDLAEDAQLSAEYLLSVYHPSDMSALMPLFREAGFYRILKRTYKLEKQYGKLVATYFEDP
DDQHAVFDAISDCLRLPRGTPLDDRRRNEALRVVQERAGNLLELCPRRAAATLASQGAEFHARIVASAEDRPELQ
FAYLKALLEPDEGGGRAQQAVAPDRQLVEHHVRLMCRFEPLRVSDYVGAVQFADLRLEELLPTMEATGVVDAAVV
LMARDGQAEKALERLVRHLFTLESVAQGLLSGVDELEDAPYDSVEDVLRGLQRYVYVGIWLCQGQSKTSQQKKAV
VSQKRQRETGQDKLSADETLWVSLIDACVQVTKRLSPALQGLAEEDGAKLVPLLRSLVQHTFTSLLKTTSGQAHE
QPGSKLLTPAGANLSFLRIMRAFLTQAAASSPDVADLREVLSSIFAAYAYEESILKLSNRLLERSLFVNVKQAVD
LRQRGWRPRGSTCEACGRRVWGPGVAGAAVLDAWEERQSLDEARRRDRKASRARIDGGEGAFEGRDKGKSPDRSA
VAEAGLEEASGTVTDDVTKETSSGPLVVLACRHIFHLSCLEPLQDGRERGFKCPVDG*
Coding >Ophcf2|02265
ATGTCTGACCCACAAGACACGTCTCCGGCGCGAGACGAAGAAGCCTGTGAGCTGGACGCTGATGTTCTCCATATG
GAGCCACAGCAGGACCGGGCGATGACGCCCGAGGCTAGTCTGCGTCCTCTGGCCGGGCCGCGGCGCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGATGGAGGGGCTGCCGAGGAGGGCAGGAAGCCCTGTTGAT
TCGCTGGCTTCTGGCGTGGGGAAGACGCCGTCTTTGCAGGGATCTCTCATGTCTTCTCCTGGGAGCAGCGTCTTG
CCCACGACAGCCTCTCGCCCCGGCCTCGGCAGCCCGACGCCTTCTTTTCGGCCTTTTGATCGCCGCTTTCACTCT
CGCTACTCGCCCTCGCCGACCAGCACTCCGCGCGGCTCGTCGCCCGCCTTCGCGTCAGGCCACAGCAGGAACGTG
TCGTTCATGTCGAATTTTCCCTTGGACCAGGCTGACACGGATACGCCTTCTGCGCCGTGGGATGTTGTTCGCTGG
ACGCGGCTCAAGAAGCTTAACAATAGTGCCTTTTCGGAGCTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTT
GCAGTTTCGACTTCCATTGTGTTGGGGACGTCTAAGGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAG
ATGATCATCGGGCAGGGCACGCAAGCCGTCGAGTCCGGCCCAGTCACGTCCATCGCCGTCTCTTCCGACCATAGC
ACCATTGCAGGTGGTCACGCCAACGGAAACATCTTTACTTGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCG
ATACCTCACCTTCATGAATCTCGGGTACAGGACCGGTCGGCTGATGGCCACATCCCCAACGTCTCCGTCGTACAC
CTAGGTTTTCTGGGAACCCGACATACGGCCCTAGTCTCGGCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCC
ACCAGGGGCACGGGTGCGCTTGGCAGGACCGTCAAGACGACCAGGATTCTCGGTCGCTATCCGGGCGCGCCTATA
CCGGCCGGGAAGCCGTTGAAGCCAAGTACCGTGCTCGCTTTCGCGCCTCTGCCGCTCGGCAACGTAGAGCGTGCC
ACTGATACCATGGGCCTGACGGCGATGCTCACCCCTTACCTGCTCGTGGTCGTGTCGACGACGCCGGTGGCCCGT
ACGCAGCACAAGTCGGCTCGGCCGAAAGAGGTTCCCGCCCACGCCGCAATGACCGGCTGCCTCGCCTGGTTCCCG
GCTGTGAAGCTCAAGGTGCCGGATCCCGCCTCCGGCAGCGACGTGTCAAAGGTCAAGCTCGTCTACTGCTGGTCC
AACGTGCTGACGGTGCTCGACGTGGACGAGACGCCGAGCGAGGATCCCGATCAGCCGTCGTCGCTCAAGTTCAAG
GCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTCGCCGTCCAGTGGCTGACGCGCTCCGTCTTGACCGTGCTC
ACCATTTCTCAGAGACTCATCGTACTGGAGGACGGGACACTACGGATGACCGAGGCTTTGGATCTGCTGCAGAAG
CACATCTACCACACTGATCTCTTCTCCAAACAGCTGCACATGTTGGTCGAGCAGCTCGACAACGAGGACGACTCG
ATGCACGGCGTCGTTGCCGATGCCTTTTACATGAGTTTCAAGGCGTACAAGGGTAGGATATTCCTGCTCGGCTTC
AGCGAGGTCTCCATCGGCGCCCTCGCCAACTGGGCAGACCGCCTGATCGCCATGATGGAGCACGGCGACTACGTG
GGAGCCATCAGGCTGGCGACGTCTTACTACGCCGGTGACGCCGACAAGCTCACCATAGGCCTTCCCGAGGACGCC
CAATTGCGGCATACCATGGTGCGGGACAAGATTGTCGAGATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAG
AGGCTCAGGAACAGCGACAGCGCCGATGATGATCAGCTCCGTCGCCTCGCCGAGGCCTGTTTCGCCGCCTGCCAG
GCGATTGACACGACCGACTACCTCTTCGACGAGGTTTATGAACGGTACGAGGCCGCCGCCGCAACGGGCATCTTC
CACGAGACGTTGGAGCCGTACGTCCTCGACGAGTCCATCACTTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTC
GCCTACTACGTTTCATGCGGCTGGGAGGGTCGTCTTGAAGAGCTCATCTGCCGCATGCAGACGGCCACCTTTGAC
CTGGATCGGATCACGACTCTCTGCAAGGAGAATGGCCTATACGACGCGCTCATCTACGTCTGGAACCAGGCGCTG
GGCGACTACATCAGCCCGATGATGGACCTGCTGAGCTTGCTGGTGCCGCTGACTGCCAACGGGCAGCACGGCGCG
GTGGCGTCCGAGGACTACTATGGCGTCAACGCGCTCAAGATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGT
GCGTATCCGAGCGGGGACCTGATGGACGACGGAACGGCGTCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTC
TCCGGCAAGACCATAGAGTGGCCAAGGGGCAGCGGCCGAGAACTGTTGACGCGTCCGCCGGGCGAGGCCGAGCCG
GCGTTTCCCTACCTCTGGATGGTGCTCAAGTTCGACGCGCCCAGCTTCCTGAGTGCGCTGAACGAGGCTTTCGAG
GATAGCTTCCTGAATGATTCGCCTGATCGGCGCGTCAACGGCGGCGCGGGCGCGGATATGCCTGAGGAGCAGGTC
TTTAGCCTGGCCATCAATCGTCAGTATATCGTGGCGATTCTCGTCGACGTCATGGGTCCGGACAAGTTTTCGCCC
GAGGACACCATCTACCTCGACATGTTCATCGCTCGCAACCTACCCAAGTTTCCGCAATATCTCTTGTTTTCGGGC
TCGACGCTCTCGCGAGTGCTGTCCAACCTCTGTTCCTATCCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGC
GCCGAATACCTCTTGTCGGTCTACCACCCGTCCGACATGTCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTC
TACCGCATACTGAAGCGCACCTACAAGTTGGAGAAGCAGTACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCG
GACGATCAGCATGCAGTGTTCGATGCCATCTCGGACTGCCTGCGGCTCCCGCGTGGAACGCCCCTTGACGATCGG
CGGAGGAACGAGGCGCTTCGGGTCGTCCAAGAGCGGGCCGGCAATCTGCTAGAGCTGTGTCCCAGGCGGGCGGCG
GCCACTCTCGCATCGCAGGGGGCTGAATTCCATGCCCGCATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAG
TTTGCCTACCTCAAGGCCCTGCTGGAGCCCGACGAGGGGGGGGGCAGGGCGCAGCAGGCCGTGGCCCCTGACCGG
CAGCTGGTGGAGCATCATGTCCGCCTCATGTGCCGGTTCGAGCCCCTACGCGTCTCGGACTACGTCGGCGCGGTG
CAGTTTGCGGACCTTCGCCTCGAGGAGCTGCTGCCGACGATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTG
CTGATGGCTCGCGATGGCCAGGCTGAAAAGGCCCTTGAACGGCTGGTCAGGCACCTCTTCACCCTCGAGTCTGTC
GCCCAGGGTCTCCTGAGCGGCGTCGACGAGCTGGAGGATGCTCCCTACGACTCGGTAGAGGACGTGCTTCGCGGG
CTACAAAGATACGTCTACGTCGGCATCTGGCTGTGTCAGGGACAGTCCAAGACGTCCCAACAGAAAAAGGCCGTC
GTGTCGCAGAAGAGACAGCGAGAGACGGGCCAGGACAAGCTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATC
GACGCCTGCGTTCAGGTGACGAAGCGGCTGTCTCCGGCGCTGCAGGGGCTAGCGGAAGAAGACGGCGCGAAGCTG
GTGCCACTCCTCCGGTCGCTCGTTCAGCATACCTTTACCTCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAG
CAGCCCGGTAGCAAGCTCTTGACCCCCGCCGGTGCGAACTTGTCCTTCCTGCGAATCATGAGGGCCTTTCTCACG
CAAGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGCGAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTAC
GAAGAGTCGATACTCAAGCTGTCGAATCGGCTGCTCGAGCGGAGTCTCTTCGTCAACGTCAAGCAGGCCGTTGAC
CTGAGGCAGCGCGGCTGGCGGCCCCGAGGCTCAACGTGCGAGGCCTGCGGTAGAAGAGTCTGGGGACCCGGCGTG
GCTGGCGCCGCCGTCCTGGATGCCTGGGAGGAGCGGCAGTCGCTCGATGAGGCGAGGAGAAGAGACCGCAAGGCG
AGCAGGGCTAGGATCGACGGCGGCGAGGGCGCCTTCGAGGGTAGGGACAAGGGAAAGAGCCCGGACAGGAGCGCG
GTGGCGGAGGCCGGGCTGGAGGAAGCATCGGGGACTGTGACGGACGACGTCACCAAGGAGACGTCCAGCGGGCCG
CTGGTGGTGTTGGCGTGCCGGCACATATTTCACCTGAGCTGCCTCGAGCCGCTGCAGGATGGGCGGGAGAGGGGC
TTCAAGTGCCCTGTTGACGGGTAG
Transcript >Ophcf2|02265
ATGTCTGACCCACAAGACACGTCTCCGGCGCGAGACGAAGAAGCCTGTGAGCTGGACGCTGATGTTCTCCATATG
GAGCCACAGCAGGACCGGGCGATGACGCCCGAGGCTAGTCTGCGTCCTCTGGCCGGGCCGCGGCGCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGATGGAGGGGCTGCCGAGGAGGGCAGGAAGCCCTGTTGAT
TCGCTGGCTTCTGGCGTGGGGAAGACGCCGTCTTTGCAGGGATCTCTCATGTCTTCTCCTGGGAGCAGCGTCTTG
CCCACGACAGCCTCTCGCCCCGGCCTCGGCAGCCCGACGCCTTCTTTTCGGCCTTTTGATCGCCGCTTTCACTCT
CGCTACTCGCCCTCGCCGACCAGCACTCCGCGCGGCTCGTCGCCCGCCTTCGCGTCAGGCCACAGCAGGAACGTG
TCGTTCATGTCGAATTTTCCCTTGGACCAGGCTGACACGGATACGCCTTCTGCGCCGTGGGATGTTGTTCGCTGG
ACGCGGCTCAAGAAGCTTAACAATAGTGCCTTTTCGGAGCTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTT
GCAGTTTCGACTTCCATTGTGTTGGGGACGTCTAAGGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAG
ATGATCATCGGGCAGGGCACGCAAGCCGTCGAGTCCGGCCCAGTCACGTCCATCGCCGTCTCTTCCGACCATAGC
ACCATTGCAGGTGGTCACGCCAACGGAAACATCTTTACTTGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCG
ATACCTCACCTTCATGAATCTCGGGTACAGGACCGGTCGGCTGATGGCCACATCCCCAACGTCTCCGTCGTACAC
CTAGGTTTTCTGGGAACCCGACATACGGCCCTAGTCTCGGCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCC
ACCAGGGGCACGGGTGCGCTTGGCAGGACCGTCAAGACGACCAGGATTCTCGGTCGCTATCCGGGCGCGCCTATA
CCGGCCGGGAAGCCGTTGAAGCCAAGTACCGTGCTCGCTTTCGCGCCTCTGCCGCTCGGCAACGTAGAGCGTGCC
ACTGATACCATGGGCCTGACGGCGATGCTCACCCCTTACCTGCTCGTGGTCGTGTCGACGACGCCGGTGGCCCGT
ACGCAGCACAAGTCGGCTCGGCCGAAAGAGGTTCCCGCCCACGCCGCAATGACCGGCTGCCTCGCCTGGTTCCCG
GCTGTGAAGCTCAAGGTGCCGGATCCCGCCTCCGGCAGCGACGTGTCAAAGGTCAAGCTCGTCTACTGCTGGTCC
AACGTGCTGACGGTGCTCGACGTGGACGAGACGCCGAGCGAGGATCCCGATCAGCCGTCGTCGCTCAAGTTCAAG
GCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTCGCCGTCCAGTGGCTGACGCGCTCCGTCTTGACCGTGCTC
ACCATTTCTCAGAGACTCATCGTACTGGAGGACGGGACACTACGGATGACCGAGGCTTTGGATCTGCTGCAGAAG
CACATCTACCACACTGATCTCTTCTCCAAACAGCTGCACATGTTGGTCGAGCAGCTCGACAACGAGGACGACTCG
ATGCACGGCGTCGTTGCCGATGCCTTTTACATGAGTTTCAAGGCGTACAAGGGTAGGATATTCCTGCTCGGCTTC
AGCGAGGTCTCCATCGGCGCCCTCGCCAACTGGGCAGACCGCCTGATCGCCATGATGGAGCACGGCGACTACGTG
GGAGCCATCAGGCTGGCGACGTCTTACTACGCCGGTGACGCCGACAAGCTCACCATAGGCCTTCCCGAGGACGCC
CAATTGCGGCATACCATGGTGCGGGACAAGATTGTCGAGATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAG
AGGCTCAGGAACAGCGACAGCGCCGATGATGATCAGCTCCGTCGCCTCGCCGAGGCCTGTTTCGCCGCCTGCCAG
GCGATTGACACGACCGACTACCTCTTCGACGAGGTTTATGAACGGTACGAGGCCGCCGCCGCAACGGGCATCTTC
CACGAGACGTTGGAGCCGTACGTCCTCGACGAGTCCATCACTTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTC
GCCTACTACGTTTCATGCGGCTGGGAGGGTCGTCTTGAAGAGCTCATCTGCCGCATGCAGACGGCCACCTTTGAC
CTGGATCGGATCACGACTCTCTGCAAGGAGAATGGCCTATACGACGCGCTCATCTACGTCTGGAACCAGGCGCTG
GGCGACTACATCAGCCCGATGATGGACCTGCTGAGCTTGCTGGTGCCGCTGACTGCCAACGGGCAGCACGGCGCG
GTGGCGTCCGAGGACTACTATGGCGTCAACGCGCTCAAGATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGT
GCGTATCCGAGCGGGGACCTGATGGACGACGGAACGGCGTCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTC
TCCGGCAAGACCATAGAGTGGCCAAGGGGCAGCGGCCGAGAACTGTTGACGCGTCCGCCGGGCGAGGCCGAGCCG
GCGTTTCCCTACCTCTGGATGGTGCTCAAGTTCGACGCGCCCAGCTTCCTGAGTGCGCTGAACGAGGCTTTCGAG
GATAGCTTCCTGAATGATTCGCCTGATCGGCGCGTCAACGGCGGCGCGGGCGCGGATATGCCTGAGGAGCAGGTC
TTTAGCCTGGCCATCAATCGTCAGTATATCGTGGCGATTCTCGTCGACGTCATGGGTCCGGACAAGTTTTCGCCC
GAGGACACCATCTACCTCGACATGTTCATCGCTCGCAACCTACCCAAGTTTCCGCAATATCTCTTGTTTTCGGGC
TCGACGCTCTCGCGAGTGCTGTCCAACCTCTGTTCCTATCCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGC
GCCGAATACCTCTTGTCGGTCTACCACCCGTCCGACATGTCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTC
TACCGCATACTGAAGCGCACCTACAAGTTGGAGAAGCAGTACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCG
GACGATCAGCATGCAGTGTTCGATGCCATCTCGGACTGCCTGCGGCTCCCGCGTGGAACGCCCCTTGACGATCGG
CGGAGGAACGAGGCGCTTCGGGTCGTCCAAGAGCGGGCCGGCAATCTGCTAGAGCTGTGTCCCAGGCGGGCGGCG
GCCACTCTCGCATCGCAGGGGGCTGAATTCCATGCCCGCATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAG
TTTGCCTACCTCAAGGCCCTGCTGGAGCCCGACGAGGGGGGGGGCAGGGCGCAGCAGGCCGTGGCCCCTGACCGG
CAGCTGGTGGAGCATCATGTCCGCCTCATGTGCCGGTTCGAGCCCCTACGCGTCTCGGACTACGTCGGCGCGGTG
CAGTTTGCGGACCTTCGCCTCGAGGAGCTGCTGCCGACGATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTG
CTGATGGCTCGCGATGGCCAGGCTGAAAAGGCCCTTGAACGGCTGGTCAGGCACCTCTTCACCCTCGAGTCTGTC
GCCCAGGGTCTCCTGAGCGGCGTCGACGAGCTGGAGGATGCTCCCTACGACTCGGTAGAGGACGTGCTTCGCGGG
CTACAAAGATACGTCTACGTCGGCATCTGGCTGTGTCAGGGACAGTCCAAGACGTCCCAACAGAAAAAGGCCGTC
GTGTCGCAGAAGAGACAGCGAGAGACGGGCCAGGACAAGCTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATC
GACGCCTGCGTTCAGGTGACGAAGCGGCTGTCTCCGGCGCTGCAGGGGCTAGCGGAAGAAGACGGCGCGAAGCTG
GTGCCACTCCTCCGGTCGCTCGTTCAGCATACCTTTACCTCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAG
CAGCCCGGTAGCAAGCTCTTGACCCCCGCCGGTGCGAACTTGTCCTTCCTGCGAATCATGAGGGCCTTTCTCACG
CAAGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGCGAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTAC
GAAGAGTCGATACTCAAGCTGTCGAATCGGCTGCTCGAGCGGAGTCTCTTCGTCAACGTCAAGCAGGCCGTTGAC
CTGAGGCAGCGCGGCTGGCGGCCCCGAGGCTCAACGTGCGAGGCCTGCGGTAGAAGAGTCTGGGGACCCGGCGTG
GCTGGCGCCGCCGTCCTGGATGCCTGGGAGGAGCGGCAGTCGCTCGATGAGGCGAGGAGAAGAGACCGCAAGGCG
AGCAGGGCTAGGATCGACGGCGGCGAGGGCGCCTTCGAGGGTAGGGACAAGGGAAAGAGCCCGGACAGGAGCGCG
GTGGCGGAGGCCGGGCTGGAGGAAGCATCGGGGACTGTGACGGACGACGTCACCAAGGAGACGTCCAGCGGGCCG
CTGGTGGTGTTGGCGTGCCGGCACATATTTCACCTGAGCTGCCTCGAGCCGCTGCAGGATGGGCGGGAGAGGGGC
TTCAAGTGCCCTGTTGACGGGTAG
Gene >Ophcf2|02265
ATGTCTGACCCACAAGACACGTCTCCGGCGCGAGACGAAGAAGCCTGTGAGCTGGACGCTGATGTTCTCCATATG
GAGCCACAGCAGGACCGGGCGATGACGCCCGAGGCTAGTCTGCGTCCTCTGGCCGGGCCGCGGCGCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGATGGAGGGGCTGCCGAGGAGGGCAGGAAGCCCTGTTGAT
TCGCTGGCTTCTGGCGTGGGGAAGACGCCGTCTTTGCAGGCGAGTCGCCGCTGTCTCCTGTTGCTTCGTGAAGCT
GACCTGTGGGTGTGTGAGAGTTCGCAGGGATCTCTCATGTCTTCTCCTGGGAGCAGCGTCTTGCCCACGACAGCC
TCTCGCCCCGGCCTCGGCAGCCCGACGCCTTCTTTTCGGCCTTTTGATCGCCGCTTTCACTCTCGCTACTCGCCC
TCGCCGACCAGCACTCCGCGCGGCTCGTCGCCCGCCTTCGCGTCAGGCCACAGCAGGAACGTGTCGTTCATGTCG
AATTTTCCCTTGGACCAGGCTGACACGGATACGCCTTCTGCGCCGTGGGATGTTGTTCGCTGGACGCGGCTCAAG
AAGCTTAACAATAGTGCCTTTTCGGAGCTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTTGCAGTTTCGACT
TCCATTGTGTTGGGGACGTCTAAGGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATCGGG
CAGGGCACGCAAGGTGAGTAGAGCACCATCTTTTCCCGGGCTGGTGCTAACAATTCGAGCTCTTTCCAGCCGTCG
AGTCCGGCCCAGTCACGTCCATCGCCGTCTCTTCCGACCATAGCACCATTGCAGGTGGTCACGCCAACGGAAACA
TCTTTACTTGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCGATACCTCACCTTCATGAATCTCGGGTACAGG
ACCGGTCGGCTGATGGCCACATCCCCAACGTCTCCGTCGTACACCTAGGTTTTCTGGGAACCCGACATACGGCCC
TAGTCTCGGCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCCACCAGGGGCACGGGTGCGCTTGGCAGGACCG
TCAAGACGACCAGGATTCTCGGTCGCTATCCGGGCGCGCCTATACCGGCCGGGAAGCCGTTGAAGCCAAGTACCG
TGCTCGCTTTCGCGCCTCTGCCGCTCGGCAACGTAGAGCGTGCCACTGATACCATGGGCCTGACGGCGATGCTCA
CCCCTTACCTGCTCGTGGTCGTGTCGACGACGCCGGTGGCCCGTACGCAGCACAAGTCGGCTCGGCCGAAAGAGG
TTCCCGCCCACGCCGCAATGACCGGCTGCCTCGCCTGGTTCCCGGCTGTGAAGCTCAAGGTGCCGGATCCCGCCT
CCGGCAGCGACGTGTCAAAGGTCAAGCTCGTCTACTGCTGGTCCAACGTGCTGACGGTGCTCGACGTGGACGAGA
CGCCGAGCGAGGATCCCGATCAGCCGTCGTCGCTCAAGTTCAAGGCCCGCAGCCGGTGGAAGTGCGAGGAGGCCA
TCGTCGCCGTCCAGTGGCTGACGCGCTCCGTCTTGACCGTGCTCACCATTTCTCAGAGACTCATCGTACTGGAGG
ACGGGACACTACGGATGACCGAGGCTTTGGATCTGCTGCAGAAGCACATCTACCACACTGATCTCTTCTCCAAAC
AGCTGCACATGTTGGTCGAGCAGCTCGACAACGAGGACGACTCGATGCACGGCGTCGTTGCCGATGCCTTTTACA
TGAGTTTCAAGGCGTACAAGGGTAGGATATTCCTGCTCGGCTTCAGCGAGGTCTCCATCGGCGCCCTCGCCAACT
GGGCAGACCGCCTGATCGCCATGATGGAGCACGGCGACTACGTGGGAGCCATCAGGCTGGCGACGTCTTACTACG
CCGGTGACGCCGACAAGCTCACCATAGGCCTTCCCGAGGACGCCCAATTGCGGCATACCATGGTGCGGGACAAGA
TTGTCGAGATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAGAGGCTCAGGAACAGCGACAGCGCCGATGATG
ATCAGCTCCGTCGCCTCGCCGAGGCCTGTTTCGCCGCCTGCCAGGCGATTGACACGACCGACTACCTCTTCGACG
AGGTTTATGAACGGTACGAGGCCGCCGCCGCAACGGGCATCTTCCACGAGACGTTGGAGCCGTACGTCCTCGACG
AGTCCATCACTTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTCGCCTACTACGTTTCATGCGGCTGGGAGGGTC
GTCTTGAAGAGCTCATCTGCCGCATGCAGACGGCCACCTTTGACCTGGATCGGATCACGACTCTCTGCAAGGAGA
ATGGCCTATACGACGCGCTCATCTACGTCTGGAACCAGGCGCTGGGCGACTACATCAGCCCGATGATGGACCTGC
TGAGCTTGCTGGTGCCGCTGACTGCCAACGGGCAGCACGGCGCGGTGGCGTCCGAGGACTACTATGGCGTCAACG
CGCTCAAGATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGTGCGTATCCGAGCGGGGACCTGATGGACGACG
GAACGGCGTCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTCTCCGGCAAGACCATAGAGTGGCCAAGGGGCA
GCGGCCGAGAACTGTTGACGCGTCCGCCGGGCGAGGCCGAGCCGGCGTTTCCCTACCTCTGGATGGTGCTCAAGT
TCGACGCGCCCAGCTTCCTGAGTGCGCTGAACGAGGCTTTCGAGGATAGCTTCCTGAATGATTCGCCTGATCGGC
GCGTCAACGGCGGCGCGGGCGCGGATATGCCTGAGGAGCAGGTCTTTAGCCTGGCCATCAATCGTCAGTATATCG
TGGCGATTCTCGTCGACGTCATGGGTCCGGACAAGTTTTCGCCCGAGGACACCATCTACCTCGACATGTTCATCG
CTCGCAACCTACCCAAGTTTCCGCAATATCTCTTGTTTTCGGGCTCGACGCTCTCGCGAGTGCTGTCCAACCTCT
GTTCCTATCCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGCGCCGAATACCTCTTGTCGGTCTACCACCCGT
CCGACATGTCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTCTACCGCATACTGAAGCGCACCTACAAGTTGG
AGAAGCAGTACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCGGACGATCAGCATGCAGTGTTCGATGCCATCT
CGGACTGCCTGCGGCTCCCGCGTGGAACGCCCCTTGACGATCGGCGGAGGAACGAGGCGCTTCGGGTCGTCCAAG
AGCGGGCCGGCAATCTGCTAGAGCTGTGTCCCAGGCGGGCGGCGGCCACTCTCGCATCGCAGGGGGCTGAATTCC
ATGCCCGCATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAGTTTGCCTACCTCAAGGCCCTGCTGGAGCCCG
ACGAGGGGGGGGGCAGGGCGCAGCAGGCCGTGGCCCCTGACCGGCAGCTGGTGGAGCATCATGTCCGCCTCATGT
GCCGGTTCGAGCCCCTACGCGTCTCGGACTACGTCGGCGCGGTGCAGTTTGCGGACCTTCGCCTCGAGGAGCTGC
TGCCGACGATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTGCTGATGGCTCGCGATGGCCAGGCTGAAAAGG
CCCTTGAACGGCTGGTCAGGCACCTCTTCACCCTCGAGTCTGTCGCCCAGGGTCTCCTGAGCGGCGTCGACGAGC
TGGAGGATGCTCCCTACGACTCGGTAGAGGACGTGCTTCGCGGGCTACAAAGATACGTCTACGTCGGCATCTGGC
TGTGTCAGGGACAGTCCAAGACGTCCCAACAGAAAAAGGCCGTCGTGTCGCAGAAGAGACAGCGAGAGACGGGCC
AGGACAAGCTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATCGACGCCTGCGTTCAGGTGACGAAGCGGCTGT
CTCCGGCGCTGCAGGGGCTAGCGGAAGAAGACGGCGCGAAGCTGGTGCCACTCCTCCGGTCGCTCGTTCAGCATA
CCTTTACCTCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAGCAGCCCGGTAGCAAGCTCTTGACCCCCGCCG
GTGCGAACTTGTCCTTCCTGCGAATCATGAGGGCCTTTCTCACGCAAGCGGCCGCCTCGTCGCCGGACGTGGCCG
ACCTGCGCGAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTACGAAGAGTCGATACTCAAGCTGTCGAATCGGC
TGCTCGAGCGGAGTCTCTTCGTCAACGTCAAGCAGGCCGTTGACCTGAGGCAGCGCGGCTGGCGGCCCCGAGGCT
CAACGTGCGAGGCCTGCGGTAGAAGAGTCTGGGGACCCGGCGTGGCTGGCGCCGCCGTCCTGGATGCCTGGGAGG
AGCGGCAGTCGCTCGATGAGGCGAGGAGAAGAGACCGCAAGGCGAGCAGGGCTAGGATCGACGGCGGCGAGGGCG
CCTTCGAGGGTAGGGACAAGGGAAAGAGCCCGGACAGGAGCGCGGTGGCGGAGGCCGGGCTGGAGGAAGCATCGG
GGACTGTGACGGACGACGTCACCAAGGAGACGTCCAGCGGGCCGCTGGTGGTGTTGGCGTGCCGGCACATATTTC
ACCTGAGCTGCCTCGAGCCGCTGCAGGATGGGCGGGAGAGGGGCTTCAAGTGCCCTGTTGACGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail