Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02263
Gene name
Locationscaffold_02:3080864..3082320
Strand+
Gene length (bp)1456
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.2E-11 264 308
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.6E-08 266 307
PF17123 zf-RING_11 RING-like zinc finger 2.7E-07 266 293
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.3E-07 266 307

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02263
MSVIQTALGQAARLVVRATDSLSDAATTTTSSDVQSPQTSRPTGGNQSSDNANNGNGGGGGGGGGSSPLLFFVAL
GFGVVFTNLWIIVGVKYCFRYNARNRARMTNEDGEPINMETVQRPHRRRREKKLMSMDEVNEKFPMIKYKTWMSE
RAQQGLPTAGGVSSPVSRSNSLADADGIATTSAGKELTSIQGRRPSDATADSTNPVKVSETEIKDVEKAAVESAT
ASGADPAHVPETQRLSSEDEDDDHINAALPPECLGAPGDTCAICIDVLEDDDDVRGLACGHAFHAVCVDPWLTSR
RACCPLCKADYYTPKPRPNLEAEPAPANPIGPDLGNSNLPTTPFQRVRAAVFRYRNADRSGSTTLPPPSIVRRHR
IHSPVRSGTRGRGQQLTSTHSSSHPTPPQAASSRPTQTGAGGIISSIRQKLPFARRQQPPPDASPPGEVSPSQLE
EGTQGAPRNAS*
Coding >Ophcf2|02263
ATGTCCGTCATTCAAACGGCCCTCGGCCAGGCTGCTCGCCTCGTCGTCAGGGCCACCGACTCGCTATCCGATGCC
GCCACCACCACCACCTCGAGCGATGTTCAGAGCCCGCAGACGTCGAGGCCGACTGGCGGCAATCAGAGCAGCGAC
AACGCCAACAACGGAAATGGCGGCGGCGGCGGCGGCGGCGGCGGCAGTTCCCCTCTCCTCTTCTTCGTCGCTCTC
GGCTTCGGCGTCGTTTTTACAAACCTCTGGATCATCGTCGGCGTCAAGTACTGCTTTCGCTACAATGCCCGCAAC
CGAGCCCGAATGACCAACGAGGACGGCGAGCCCATCAACATGGAGACCGTTCAGCGCCCCCATCGGAGACGCCGA
GAGAAGAAGCTCATGTCCATGGACGAGGTCAACGAAAAGTTCCCCATGATCAAATACAAGACGTGGATGTCAGAG
CGAGCCCAACAGGGCCTTCCCACTGCTGGTGGCGTTTCCTCACCCGTCAGCCGCTCCAACAGTCTGGCCGACGCC
GACGGCATTGCCACCACTTCTGCCGGCAAAGAACTCACCTCTATTCAAGGCCGCCGGCCGTCTGACGCTACCGCC
GACTCGACCAACCCCGTAAAAGTTTCCGAGACCGAAATCAAGGACGTCGAAAAGGCTGCTGTCGAGTCGGCTACT
GCCAGCGGCGCTGATCCCGCCCACGTCCCCGAAACCCAGCGCCTATCCAGCGAGGATGAAGATGACGACCATATC
AACGCCGCCCTGCCTCCCGAATGCCTAGGCGCCCCCGGCGATACATGTGCCATATGCATCGACGTACTCGAGGAC
GATGACGACGTTCGAGGTCTCGCCTGTGGTCACGCCTTTCACGCCGTCTGCGTGGACCCCTGGCTCACCAGCCGT
CGCGCCTGTTGCCCCCTCTGCAAGGCCGACTATTACACCCCCAAGCCGCGACCGAATCTCGAAGCCGAGCCCGCC
CCCGCGAACCCTATCGGTCCCGACCTCGGCAATAGCAACCTTCCTACCACTCCCTTCCAGCGCGTTCGGGCCGCC
GTCTTCCGATACCGGAATGCCGACCGGTCAGGGTCCACCACGCTGCCGCCGCCATCGATTGTTCGCCGTCATCGG
ATCCATTCCCCGGTTAGGTCCGGCACGCGCGGTCGTGGCCAGCAGTTGACCTCCACCCACTCGTCGAGCCATCCA
ACGCCGCCCCAAGCCGCATCCTCTCGCCCGACTCAGACCGGCGCGGGCGGCATAATCTCGTCGATCCGGCAGAAG
TTACCCTTTGCCCGGCGGCAACAACCTCCCCCAGATGCTTCCCCGCCCGGCGAGGTATCTCCCTCTCAGCTCGAG
GAGGGTACTCAAGGGGCGCCGCGGAATGCTTCTTGA
Transcript >Ophcf2|02263
ATGTCCGTCATTCAAACGGCCCTCGGCCAGGCTGCTCGCCTCGTCGTCAGGGCCACCGACTCGCTATCCGATGCC
GCCACCACCACCACCTCGAGCGATGTTCAGAGCCCGCAGACGTCGAGGCCGACTGGCGGCAATCAGAGCAGCGAC
AACGCCAACAACGGAAATGGCGGCGGCGGCGGCGGCGGCGGCGGCAGTTCCCCTCTCCTCTTCTTCGTCGCTCTC
GGCTTCGGCGTCGTTTTTACAAACCTCTGGATCATCGTCGGCGTCAAGTACTGCTTTCGCTACAATGCCCGCAAC
CGAGCCCGAATGACCAACGAGGACGGCGAGCCCATCAACATGGAGACCGTTCAGCGCCCCCATCGGAGACGCCGA
GAGAAGAAGCTCATGTCCATGGACGAGGTCAACGAAAAGTTCCCCATGATCAAATACAAGACGTGGATGTCAGAG
CGAGCCCAACAGGGCCTTCCCACTGCTGGTGGCGTTTCCTCACCCGTCAGCCGCTCCAACAGTCTGGCCGACGCC
GACGGCATTGCCACCACTTCTGCCGGCAAAGAACTCACCTCTATTCAAGGCCGCCGGCCGTCTGACGCTACCGCC
GACTCGACCAACCCCGTAAAAGTTTCCGAGACCGAAATCAAGGACGTCGAAAAGGCTGCTGTCGAGTCGGCTACT
GCCAGCGGCGCTGATCCCGCCCACGTCCCCGAAACCCAGCGCCTATCCAGCGAGGATGAAGATGACGACCATATC
AACGCCGCCCTGCCTCCCGAATGCCTAGGCGCCCCCGGCGATACATGTGCCATATGCATCGACGTACTCGAGGAC
GATGACGACGTTCGAGGTCTCGCCTGTGGTCACGCCTTTCACGCCGTCTGCGTGGACCCCTGGCTCACCAGCCGT
CGCGCCTGTTGCCCCCTCTGCAAGGCCGACTATTACACCCCCAAGCCGCGACCGAATCTCGAAGCCGAGCCCGCC
CCCGCGAACCCTATCGGTCCCGACCTCGGCAATAGCAACCTTCCTACCACTCCCTTCCAGCGCGTTCGGGCCGCC
GTCTTCCGATACCGGAATGCCGACCGGTCAGGGTCCACCACGCTGCCGCCGCCATCGATTGTTCGCCGTCATCGG
ATCCATTCCCCGGTTAGGTCCGGCACGCGCGGTCGTGGCCAGCAGTTGACCTCCACCCACTCGTCGAGCCATCCA
ACGCCGCCCCAAGCCGCATCCTCTCGCCCGACTCAGACCGGCGCGGGCGGCATAATCTCGTCGATCCGGCAGAAG
TTACCCTTTGCCCGGCGGCAACAACCTCCCCCAGATGCTTCCCCGCCCGGCGAGGTATCTCCCTCTCAGCTCGAG
GAGGGTACTCAAGGGGCGCCGCGGAATGCTTCTTGA
Gene >Ophcf2|02263
ATGTCCGTCATTCAAACGGCCCTCGGCCAGGCTGCTCGCCTCGTCGTCAGGGCCACCGACTCGCTATCCGATGCC
GCCACCACCACCACCTCGAGCGATGTTCAGAGCCCGCAGACGTCGAGGCCGACTGGCGGCAATCAGAGCAGCGAC
AACGCCAACAACGGAAATGGCGGCGGCGGCGGCGGCGGCGGCGGCAGTTCCCCTCTCCTCTTCTTCGTCGCTCTC
GGCTTCGGCGTCGTTTTTACAAACCTCTGGTGAGTGTCGCATCGCATCGCATCGCCCCCTTCGCTTCCTCTCACG
TATGCTCACCGCTGGCGCTGTCAGGATCATCGTCGGCGTCAAGTACTGCTTTCGCTACAATGCCCGCAACCGAGC
CCGAATGACCAACGAGGACGGCGAGCCCATCAACATGGAGACCGTTCAGCGCCCCCATCGGAGACGCCGAGAGAA
GAAGCTCATGTCCATGGACGAGGTCAACGAAAAGTTCCCCATGATCAAATACAAGACGTGGATGTCAGAGCGAGC
CCAACAGGGCCTTCCCACTGCTGGTGGCGTTTCCTCACCCGTCAGCCGCTCCAACAGTCTGGCCGACGCCGACGG
CATTGCCACCACTTCTGCCGGCAAAGAACTCACCTCTATTCAAGGCCGCCGGCCGTCTGACGCTACCGCCGACTC
GACCAACCCCGTAAAAGTTTCCGAGACCGAAATCAAGGACGTCGAAAAGGCTGCTGTCGAGTCGGCTACTGCCAG
CGGCGCTGATCCCGCCCACGTCCCCGAAACCCAGCGCCTATCCAGCGAGGATGAAGATGACGACCATATCAACGC
CGCCCTGCCTCCCGAATGCCTAGGCGCCCCCGGCGATACATGTGCCATATGCATCGACGTACTCGAGGACGATGA
CGACGTTCGAGGTCTCGCCTGTGGTCACGCCTTTCACGCCGTCTGCGTGGACCCCTGGCTCACCAGCCGTCGCGC
CTGTTGCCCCCTCTGCAAGGCCGACTATTACACCCCCAAGCCGCGACCGAATCTCGAAGCCGAGCCCGCCCCCGC
GAACCCTATCGGTCCCGACCTCGGCAATAGCAACCTTCCTACCACTCCCTTCCAGCGCGTTCGGGCCGCCGTCTT
CCGATACCGGAATGCCGACCGGTCAGGGTCCACCACGCTGCCGCCGCCATCGATTGTTCGCCGTCATCGGATCCA
TTCCCCGGTTAGGTCCGGCACGCGCGGTCGTGGCCAGCAGTTGACCTCCACCCACTCGTCGAGCCATCCAACGCC
GCCCCAAGCCGCATCCTCTCGCCCGACTCAGACCGGCGCGGGCGGCATAATCTCGTCGATCCGGCAGAAGTTACC
CTTTGCCCGGCGGCAACAACCTCCCCCAGATGCTTCCCCGCCCGGCGAGGTATCTCCCTCTCAGCTCGAGGAGGG
TACTCAAGGGGCGCCGCGGAATGCTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail