Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02247
Gene name
Locationscaffold_02:3033822..3034251
Strand+
Gene length (bp)429
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12907 zf-met2 Zinc-binding 5.9E-16 35 70
PF04419 4F5 4F5 protein related disordered region 2.2E-06 1 32

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5374 0.5862 0.1409 0.1968 0.1171 0.0055 0.0512 0.0123 0.0444 0.0005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6052
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4415
Ophiocordyceps camponoti-floridani Ophcf2|02247 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4730
Ophiocordyceps subramaniannii Hirsu2|2043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02247
MGNGAKAQQKRERSQKEGKAAKSQLKVNEQAKSIQCQICKATFLQTTKAPALLEHASNKHSKGLTDCFPGSNS*
Coding >Ophcf2|02247
ATGGGCAACGGAGCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGAAGGCAAGGCCGCAAAGTCGCAGCTC
AAAGTCAACGAACAGGCCAAGAGCATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACCACCAAGGCTCCA
GCGTTACTGGAGCATGCCTCCAACAAACATTCTAAGGGCCTGACTGACTGCTTTCCCGGCTCCAATAGCTGA
Transcript >Ophcf2|02247
ATGGGCAACGGAGCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGAAGGCAAGGCCGCAAAGTCGCAGCTC
AAAGTCAACGAACAGGCCAAGAGCATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACCACCAAGGCTCCA
GCGTTACTGGAGCATGCCTCCAACAAACATTCTAAGGGCCTGACTGACTGCTTTCCCGGCTCCAATAGCTGA
Gene >Ophcf2|02247
ATGGGCAACGTCAGTCTTTGCGACGCCTCTGCCTCATCATCACCGACTTGCTGACCGCCCTTTGCGCGCTTCAGG
GAGCCAAGGCGCAACAGAAGCGCGAGCGCAGCCAAAAGGAAGGCAAGGCCGCAAAGTCGCAGCTCAAAGTCGTTC
GTCAGCCCGCATCTCCGCGCCCTCTTGATGTTTGTGAACGAGAAATAACTCCCCCCCCTCCTCCCCCCCTTCCGA
CAGAACGAACAGGCCAAGAGCATCCAATGCCAGATCTGCAAGGCCACCTTTCTCCAGACCACCAAGGCTCCAGCG
TCCGTCGCCGCCACCGCTTGTCCTCTTCTCGCTGTCTCGCTGACCTGACGTCTGTGCAGGTTACTGGAGCATGCC
TCCAACAAACATTCTAAGGGCCTGACTGACTGCTTTCCCGGCTCCAATAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail