Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02232
Gene name
Locationscaffold_02:2986634..2989384
Strand+
Gene length (bp)2750
Transcript length (bp)2628
Coding sequence length (bp)2628
Protein length (aa) 876

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 8.1E-23 413 465

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4043 0.7661 0.1759 0.0676 0.1557 0.0425 0.0466 0.0755 0.0391 0.0377

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3697
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5130
Ophiocordyceps australis map64 (Brazil) OphauB2|1419
Ophiocordyceps camponoti-floridani Ophcf2|02232 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|559
Ophiocordyceps kimflemingae Ophio5|5872
Ophiocordyceps subramaniannii Hirsu2|7197

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02232
MFNHPTPRPHPSNGFPNDSFSFSSHQPWTRFDLYQTPDADPHESPQSYAPSSMDWTPTSDDTPSYHHANDEVELD
SLSSIHVQGADGTAGPGGVGRLVAHFENKGYTPFENKPYAPPTTTLPSSRGGQTGLDTQQPLSKPHFDQLSYFGP
GPGPGPGNAPGLAASPFSSDRSAPVTGLGDSSWASYGLHPRVPSPLSATNPSSVGFGTFQETPRVTGPVPTPMSA
QFGGLDVFSSGNRVPGPAGPPPLPTPQMAPSPMLSPTQTSPPVAGTPGFEIWRPPGSTVAVKPAPAPTTTTPVVP
RNGAFIKPPVPSTPKPNVNGSGNQFILEFNPSATSKAAKGKAPAKPARLRAPPAVPSPFSPEVKQEPVTPGAPDR
PSSSSTVAASLPTQVQRPASTSVRAHTGSRPSREQVPAEAWEQFKSTIRTLYLDERRPLKEVMAIMAEKYNFQAT
PKMYKTRFSQWGFVKNNTEDEVKRLLSMKFQRDAEGKVSEFVRNGRVVNLGTYLKRKGVTEYDLIDFELPADLPA
HVKCRTPTPPPAPDYLRSPDLLRAQELVVGNMRKAFLHCRQIEVETELQVGWPMTMVWGADSSDLLMEANFYFEA
RDADMGGRFLMRAFKLLEADLKKLSPLGIKELLLGMVQRDPGMMTALCKYLAAYSTTNLERSHPLRQIFTCLYEV
QQKHGPGTLSDLLWGSTPTIAEELEAIYSRRHPYVARTWIDLALFYNHVHVERLEKILAELRTLERSVEQRHGLR
SADLMSLRYSMMQLLYVLAPQSEASKQAAVDMWSYMRFMGTVFPVRDERSPNVYCYHTPIKVDPSRKRCRRRYDL
GVTILEKHLGVKVMPYFEEDFHTTAHAHDAQEAWSTAVNHVQSNPKFFFI*
Coding >Ophcf2|02232
ATGTTCAATCATCCCACCCCGCGACCGCACCCTTCAAATGGCTTCCCCAACGACTCCTTTTCCTTTTCTTCTCAT
CAGCCATGGACCAGGTTCGACCTCTATCAGACGCCCGACGCCGACCCCCATGAGTCTCCTCAGTCTTATGCTCCC
TCGTCCATGGATTGGACCCCAACCTCGGACGACACCCCTTCCTATCATCACGCCAATGACGAGGTAGAGCTCGAT
TCGCTGAGTTCTATCCATGTCCAAGGCGCCGATGGGACCGCCGGACCCGGAGGTGTCGGTCGTCTGGTTGCTCAT
TTCGAGAACAAGGGATATACCCCTTTCGAAAACAAGCCCTACGCGCCTCCCACCACCACTCTGCCCTCGTCCAGG
GGCGGACAGACGGGCCTCGACACCCAGCAACCCTTGTCCAAGCCTCACTTTGACCAGCTTTCCTACTTCGGCCCT
GGCCCCGGTCCCGGTCCCGGTAACGCCCCCGGACTGGCCGCCTCACCCTTTTCCTCCGATCGGTCCGCCCCCGTC
ACCGGCCTGGGTGATTCTTCCTGGGCGTCTTACGGCCTGCATCCGCGCGTCCCCAGCCCCCTGTCCGCCACCAAC
CCGTCCTCCGTCGGCTTCGGCACCTTCCAGGAGACGCCGCGGGTGACGGGACCGGTTCCGACCCCGATGTCGGCC
CAGTTCGGTGGGCTGGACGTCTTCTCCTCCGGGAACCGCGTGCCCGGTCCGGCCGGACCACCTCCGCTCCCGACG
CCGCAGATGGCTCCCTCTCCCATGCTCAGTCCGACGCAGACTTCGCCTCCGGTGGCCGGCACCCCGGGCTTCGAG
ATCTGGCGTCCGCCGGGGTCGACGGTGGCTGTGAAGCCGGCTCCGGCTCCGACGACGACGACGCCGGTAGTGCCC
CGTAACGGAGCCTTCATCAAGCCCCCGGTCCCGTCGACTCCAAAACCAAACGTCAACGGAAGCGGGAACCAGTTC
ATCCTCGAATTCAACCCCTCTGCCACATCAAAGGCCGCCAAGGGGAAGGCTCCGGCCAAGCCGGCGAGATTGCGG
GCGCCTCCGGCCGTACCATCGCCTTTCAGCCCCGAGGTCAAGCAAGAGCCGGTGACGCCCGGTGCTCCTGACCGG
CCGTCTTCGTCGTCGACGGTGGCCGCATCTCTGCCGACGCAGGTTCAGAGGCCGGCTTCGACGTCGGTCCGCGCA
CACACCGGGAGCCGACCTTCGCGGGAGCAGGTTCCGGCAGAGGCCTGGGAGCAGTTCAAGTCGACCATTCGGACG
CTGTATCTCGATGAGAGGCGGCCGCTCAAGGAGGTCATGGCCATCATGGCGGAAAAGTACAATTTCCAAGCCACA
CCCAAGATGTACAAGACTCGCTTCTCGCAATGGGGCTTCGTCAAGAACAACACCGAGGATGAGGTCAAGCGGCTG
CTGTCGATGAAGTTCCAGCGCGATGCTGAGGGTAAGGTGTCCGAGTTCGTCCGTAACGGCCGCGTCGTCAATCTG
GGCACCTATCTGAAGCGCAAGGGCGTCACCGAGTACGACCTGATCGACTTCGAGCTTCCGGCCGACCTCCCGGCT
CACGTCAAGTGCCGGACGCCGACGCCGCCACCGGCCCCCGATTACCTCCGGTCGCCGGACCTCCTCCGGGCGCAG
GAGCTCGTCGTCGGCAACATGCGCAAGGCCTTTCTTCACTGCCGTCAGATCGAGGTCGAGACGGAGCTGCAGGTG
GGATGGCCCATGACCATGGTCTGGGGCGCAGACTCGAGCGACCTCCTGATGGAGGCCAACTTTTACTTCGAGGCT
CGTGACGCTGACATGGGCGGCCGCTTCCTCATGCGGGCCTTTAAGCTTCTCGAGGCTGACCTCAAGAAACTGTCG
CCACTGGGTATCAAGGAGCTGCTGCTGGGCATGGTACAGCGGGATCCGGGCATGATGACGGCCCTTTGCAAGTAT
CTGGCCGCCTACTCGACCACCAACTTGGAGCGGTCTCATCCGCTGCGCCAGATCTTTACCTGTCTTTACGAGGTA
CAGCAGAAGCACGGCCCCGGAACGCTGTCGGACCTGCTATGGGGGAGCACGCCGACCATTGCCGAGGAGCTCGAG
GCCATCTACAGCCGGAGACATCCATACGTGGCCCGTACCTGGATCGACCTGGCCCTCTTCTACAACCACGTTCAC
GTTGAGCGGCTCGAGAAGATACTGGCCGAGCTGCGGACGCTGGAAAGATCCGTCGAGCAGCGACACGGCCTCCGA
AGCGCCGACCTCATGTCCTTGCGCTACTCCATGATGCAGCTGCTGTACGTGCTGGCGCCTCAGAGCGAAGCCTCC
AAGCAAGCGGCCGTCGACATGTGGAGCTATATGCGATTCATGGGCACCGTCTTCCCCGTCCGGGACGAGCGCTCT
CCCAACGTTTACTGCTATCACACGCCCATCAAGGTCGACCCGTCCAGGAAGCGGTGCAGAAGACGATACGACCTG
GGCGTCACCATCCTCGAGAAGCACCTGGGCGTCAAGGTGATGCCCTACTTTGAGGAGGACTTTCATACCACGGCG
CACGCCCACGATGCTCAGGAGGCCTGGTCAACGGCCGTCAATCACGTCCAGTCCAACCCCAAGTTTTTCTTTATC
TGA
Transcript >Ophcf2|02232
ATGTTCAATCATCCCACCCCGCGACCGCACCCTTCAAATGGCTTCCCCAACGACTCCTTTTCCTTTTCTTCTCAT
CAGCCATGGACCAGGTTCGACCTCTATCAGACGCCCGACGCCGACCCCCATGAGTCTCCTCAGTCTTATGCTCCC
TCGTCCATGGATTGGACCCCAACCTCGGACGACACCCCTTCCTATCATCACGCCAATGACGAGGTAGAGCTCGAT
TCGCTGAGTTCTATCCATGTCCAAGGCGCCGATGGGACCGCCGGACCCGGAGGTGTCGGTCGTCTGGTTGCTCAT
TTCGAGAACAAGGGATATACCCCTTTCGAAAACAAGCCCTACGCGCCTCCCACCACCACTCTGCCCTCGTCCAGG
GGCGGACAGACGGGCCTCGACACCCAGCAACCCTTGTCCAAGCCTCACTTTGACCAGCTTTCCTACTTCGGCCCT
GGCCCCGGTCCCGGTCCCGGTAACGCCCCCGGACTGGCCGCCTCACCCTTTTCCTCCGATCGGTCCGCCCCCGTC
ACCGGCCTGGGTGATTCTTCCTGGGCGTCTTACGGCCTGCATCCGCGCGTCCCCAGCCCCCTGTCCGCCACCAAC
CCGTCCTCCGTCGGCTTCGGCACCTTCCAGGAGACGCCGCGGGTGACGGGACCGGTTCCGACCCCGATGTCGGCC
CAGTTCGGTGGGCTGGACGTCTTCTCCTCCGGGAACCGCGTGCCCGGTCCGGCCGGACCACCTCCGCTCCCGACG
CCGCAGATGGCTCCCTCTCCCATGCTCAGTCCGACGCAGACTTCGCCTCCGGTGGCCGGCACCCCGGGCTTCGAG
ATCTGGCGTCCGCCGGGGTCGACGGTGGCTGTGAAGCCGGCTCCGGCTCCGACGACGACGACGCCGGTAGTGCCC
CGTAACGGAGCCTTCATCAAGCCCCCGGTCCCGTCGACTCCAAAACCAAACGTCAACGGAAGCGGGAACCAGTTC
ATCCTCGAATTCAACCCCTCTGCCACATCAAAGGCCGCCAAGGGGAAGGCTCCGGCCAAGCCGGCGAGATTGCGG
GCGCCTCCGGCCGTACCATCGCCTTTCAGCCCCGAGGTCAAGCAAGAGCCGGTGACGCCCGGTGCTCCTGACCGG
CCGTCTTCGTCGTCGACGGTGGCCGCATCTCTGCCGACGCAGGTTCAGAGGCCGGCTTCGACGTCGGTCCGCGCA
CACACCGGGAGCCGACCTTCGCGGGAGCAGGTTCCGGCAGAGGCCTGGGAGCAGTTCAAGTCGACCATTCGGACG
CTGTATCTCGATGAGAGGCGGCCGCTCAAGGAGGTCATGGCCATCATGGCGGAAAAGTACAATTTCCAAGCCACA
CCCAAGATGTACAAGACTCGCTTCTCGCAATGGGGCTTCGTCAAGAACAACACCGAGGATGAGGTCAAGCGGCTG
CTGTCGATGAAGTTCCAGCGCGATGCTGAGGGTAAGGTGTCCGAGTTCGTCCGTAACGGCCGCGTCGTCAATCTG
GGCACCTATCTGAAGCGCAAGGGCGTCACCGAGTACGACCTGATCGACTTCGAGCTTCCGGCCGACCTCCCGGCT
CACGTCAAGTGCCGGACGCCGACGCCGCCACCGGCCCCCGATTACCTCCGGTCGCCGGACCTCCTCCGGGCGCAG
GAGCTCGTCGTCGGCAACATGCGCAAGGCCTTTCTTCACTGCCGTCAGATCGAGGTCGAGACGGAGCTGCAGGTG
GGATGGCCCATGACCATGGTCTGGGGCGCAGACTCGAGCGACCTCCTGATGGAGGCCAACTTTTACTTCGAGGCT
CGTGACGCTGACATGGGCGGCCGCTTCCTCATGCGGGCCTTTAAGCTTCTCGAGGCTGACCTCAAGAAACTGTCG
CCACTGGGTATCAAGGAGCTGCTGCTGGGCATGGTACAGCGGGATCCGGGCATGATGACGGCCCTTTGCAAGTAT
CTGGCCGCCTACTCGACCACCAACTTGGAGCGGTCTCATCCGCTGCGCCAGATCTTTACCTGTCTTTACGAGGTA
CAGCAGAAGCACGGCCCCGGAACGCTGTCGGACCTGCTATGGGGGAGCACGCCGACCATTGCCGAGGAGCTCGAG
GCCATCTACAGCCGGAGACATCCATACGTGGCCCGTACCTGGATCGACCTGGCCCTCTTCTACAACCACGTTCAC
GTTGAGCGGCTCGAGAAGATACTGGCCGAGCTGCGGACGCTGGAAAGATCCGTCGAGCAGCGACACGGCCTCCGA
AGCGCCGACCTCATGTCCTTGCGCTACTCCATGATGCAGCTGCTGTACGTGCTGGCGCCTCAGAGCGAAGCCTCC
AAGCAAGCGGCCGTCGACATGTGGAGCTATATGCGATTCATGGGCACCGTCTTCCCCGTCCGGGACGAGCGCTCT
CCCAACGTTTACTGCTATCACACGCCCATCAAGGTCGACCCGTCCAGGAAGCGGTGCAGAAGACGATACGACCTG
GGCGTCACCATCCTCGAGAAGCACCTGGGCGTCAAGGTGATGCCCTACTTTGAGGAGGACTTTCATACCACGGCG
CACGCCCACGATGCTCAGGAGGCCTGGTCAACGGCCGTCAATCACGTCCAGTCCAACCCCAAGTTTTTCTTTATC
TGA
Gene >Ophcf2|02232
ATGTTCAATCATCCCACCCCGCGACCGCACCCTTCAAATGGCTTCCCCAACGACTCCTTTTCCTTTTCTTCTCAT
CAGCCATGGACCAGGTTCGACCTCTATCAGACGCCCGACGCCGACCCCCATGAGTCTCCTCAGTCTTATGCTCCC
TCGTCCATGGATTGGACCCCAACCTCGGACGACACCCCTTCCTATCATCACGCCAATGACGAGGTAGAGCTCGAT
TCGCTGAGTTCTATCCATGTCCAAGGCGCCGATGGGACCGCCGGACCCGGAGGTGTCGGTCGTCTGGTTGCTCAT
TTCGAGAACAAGGGATATACCCCTTTCGAAAACAAGCCCTACGCGCCTCCCACCACCACTCTGCCCTCGTCCAGG
GGCGGACAGACGGGCCTCGACACCCAGCAACCCTTGTCCAAGCCTCACTTTGACCAGCTTTCCTACTTCGGCCCT
GGCCCCGGTCCCGGTCCCGGTAACGCCCCCGGACTGGCCGCCTCACCCTTTTCCTCCGATCGGTCCGCCCCCGTC
ACCGGCCTGGGTGATTCTTCCTGGGCGTCTTACGGCCTGCATCCGCGCGTCCCCAGCCCCCTGTCCGCCACCAAC
CCGTCCTCCGTCGGCTTCGGCACCTTCCAGGAGACGCCGCGGGTGACGGGACCGGTTCCGACCCCGATGTCGGCC
CAGTTCGGTGGGCTGGACGTCTTCTCCTCCGGGAACCGCGTGCCCGGTCCGGCCGGACCACCTCCGCTCCCGACG
CCGCAGATGGCTCCCTCTCCCATGCTCAGTCCGACGCAGACTTCGCCTCCGGTGGCCGGCACCCCGGGCTTCGAG
ATCTGGCGTCCGCCGGGGTCGACGGTGGCTGTGAAGCCGGCTCCGGCTCCGACGACGACGACGCCGGTAGTGCCC
CGTAACGGAGCCTTCATCAAGCCCCCGGTCCCGTCGACTCCAAAACCAAACGTCAACGGAAGCGGGAACCAGTTC
ATCCTCGAATTCAACCCCTCTGCCACATCAAAGGCCGCCAAGGGGAAGGCTCCGGCCAAGCCGGCGAGATTGCGG
GCGCCTCCGGCCGTACCATCGCCTTTCAGCCCCGAGGTCAAGCAAGAGCCGGTGACGCCCGGTGCTCCTGACCGG
CCGTCTTCGTCGTCGACGGTGGCCGCATCTCTGCCGGTGAGTGGTCATCTCTTGGAGCTTCGTCGTGCTTCAGGG
GCTGCATCTCATGCGGTGCAGACGCAGGTTCAGAGGCCGGCTTCGACGTCGGTCCGCGCACACACCGGGAGCCGA
CCTTCGCGGGAGCAGGTTCCGGCAGAGGCCTGGGAGCAGTTCAAGTCGACCATTCGGACGCTGTATCTCGATGAG
AGGCGGCCGCTCAAGGAGGTCATGGCCATCATGGCGGAAAAGTACAATTTCCAAGCCACGTGAGTGAATGCACTC
GTTACCTCCTTGACTTGGAGAGCCTCCTTAACCCATTTTCGTTCAGACCCAAGATGTACAAGACTCGCTTCTCGC
AATGGGGCTTCGTCAAGAACAACACCGAGGATGAGGTCAAGCGGCTGCTGTCGATGAAGTTCCAGCGCGATGCTG
AGGGTAAGGTGTCCGAGTTCGTCCGTAACGGCCGCGTCGTCAATCTGGGCACCTATCTGAAGCGCAAGGGCGTCA
CCGAGTACGACCTGATCGACTTCGAGCTTCCGGCCGACCTCCCGGCTCACGTCAAGTGCCGGACGCCGACGCCGC
CACCGGCCCCCGATTACCTCCGGTCGCCGGACCTCCTCCGGGCGCAGGAGCTCGTCGTCGGCAACATGCGCAAGG
CCTTTCTTCACTGCCGTCAGATCGAGGTCGAGACGGAGCTGCAGGTGGGATGGCCCATGACCATGGTCTGGGGCG
CAGACTCGAGCGACCTCCTGATGGAGGCCAACTTTTACTTCGAGGCTCGTGACGCTGACATGGGCGGCCGCTTCC
TCATGCGGGCCTTTAAGCTTCTCGAGGCTGACCTCAAGAAACTGTCGCCACTGGGTATCAAGGAGCTGCTGCTGG
GCATGGTACAGCGGGATCCGGGCATGATGACGGCCCTTTGCAAGTATCTGGCCGCCTACTCGACCACCAACTTGG
AGCGGTCTCATCCGCTGCGCCAGATCTTTACCTGTCTTTACGAGGTACAGCAGAAGCACGGCCCCGGAACGCTGT
CGGACCTGCTATGGGGGAGCACGCCGACCATTGCCGAGGAGCTCGAGGCCATCTACAGCCGGAGACATCCATACG
TGGCCCGTACCTGGATCGACCTGGCCCTCTTCTACAACCACGTTCACGTTGAGCGGCTCGAGAAGATACTGGCCG
AGCTGCGGACGCTGGAAAGATCCGTCGAGCAGCGACACGGCCTCCGAAGCGCCGACCTCATGTCCTTGCGCTACT
CCATGATGCAGCTGCTGTACGTGCTGGCGCCTCAGAGCGAAGCCTCCAAGCAAGCGGCCGTCGACATGTGGAGCT
ATATGCGATTCATGGGCACCGTCTTCCCCGTCCGGGACGAGCGCTCTCCCAACGTTTACTGCTATCACACGCCCA
TCAAGGTCGACCCGTCCAGGAAGCGGTGCAGAAGACGATACGACCTGGGCGTCACCATCCTCGAGAAGCACCTGG
GCGTCAAGGTGATGCCCTACTTTGAGGAGGACTTTCATACCACGGCGCACGCCCACGATGCTCAGGAGGCCTGGT
CAACGGCCGTCAATCACGTCCAGTCCAACCCCAAGTTTTTCTTTATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail