Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02228
Gene name
Locationscaffold_02:2966406..2968986
Strand+
Gene length (bp)2580
Transcript length (bp)2580
Coding sequence length (bp)2580
Protein length (aa) 860

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.8E-22 439 720

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 67 89 22
3 102 124 22
4 147 169 22
5 248 267 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 20.34 11.14 29.54
Alive In ants, during behavior modification 13.57 6.92 20.22
Dead In ants, recently dead 9.93 4.75 15.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.039963 yes
Alive Dead 0.097911 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02228
MIYRLLGRPQATPPPPGPSLTTSVILYFFNRRVLSISRYAFSIVAVAVLAAKLVHIYAHVDAIASDLLGYGMSFF
AQDVFFLLIMRLFLDNIASLNLRSLRILAVSVASFLLAATLFFGSVSISFFVVTGTELRWRNVGVAGDSAAWGML
LSGLFSCSAVALTILLVAWPAQDVCASVFDAILNLVRWPLSFVMSKISPRAAILPLAYQHVPQDDEDSSGERKLL
TAEDVQKETSPAAEDQAHHRPSLCLHVSLAITIIIMAISSLARPVDSSLIFMSWTLPLVPFIDLLPSSPSVAGLV
PSYGTDVNSDLENRTALAEPPSWPWLPAGKALPGFEDWYEGKDHYRAEKDPLRVSNLDSALLPELRHSLGGVKIR
HVVLIKLESTRKDVFPIKKGGYIWETLAASHDNHTLPSSAVELFSKLTPNANYLTGDFDDGFDHTERKPRGGINA
NNVHTTSTYTLKSLAGTLCGLYPLVADFNREYEMHVYQPCLSHIFNAFNEMEKDKDVSGDDFSSYKWRSTFMQSV
TDGYDKQNAEMPVLGYPEGTFLSKEILQSGKGQFGKINMSDINYYGMSEEALKDYVREEFAAAKRDNGRVFLSHL
TSTTHHPFVLPEGEPYLPLSDDKKLNDLSHYVNTIGYVDHWLGQILQILEEEGVADETLLVAVGDHGLSLPENGG
VTPYYNGNVGNFHVPLVLSHPSLPAVDVNDAAASLSILPTILDLLVETGSLSSETKQAAQDLMHNYEGQSLLRPQ
RQASWETGESNWLFTVMNPGKATIAIRDAHRPDWRIIMPVIDDVEWRFTDTAKDPHEMEPVISFSFKPLLEKIER
KHGVEAAAWAETAAFKAQWWVKENNRRWRFAESK*
Coding >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA
Transcript >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA
Gene >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail