Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02228
Gene name
Locationscaffold_02:2966406..2968986
Strand+
Gene length (bp)2580
Transcript length (bp)2580
Coding sequence length (bp)2580
Protein length (aa) 860

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.8E-22 439 720

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 67 89 22
3 102 124 22
4 147 169 22
5 248 267 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02228
MIYRLLGRPQATPPPPGPSLTTSVILYFFNRRVLSISRYAFSIVAVAVLAAKLVHIYAHVDAIASDLLGYGMSFF
AQDVFFLLIMRLFLDNIASLNLRSLRILAVSVASFLLAATLFFGSVSISFFVVTGTELRWRNVGVAGDSAAWGML
LSGLFSCSAVALTILLVAWPAQDVCASVFDAILNLVRWPLSFVMSKISPRAAILPLAYQHVPQDDEDSSGERKLL
TAEDVQKETSPAAEDQAHHRPSLCLHVSLAITIIIMAISSLARPVDSSLIFMSWTLPLVPFIDLLPSSPSVAGLV
PSYGTDVNSDLENRTALAEPPSWPWLPAGKALPGFEDWYEGKDHYRAEKDPLRVSNLDSALLPELRHSLGGVKIR
HVVLIKLESTRKDVFPIKKGGYIWETLAASHDNHTLPSSAVELFSKLTPNANYLTGDFDDGFDHTERKPRGGINA
NNVHTTSTYTLKSLAGTLCGLYPLVADFNREYEMHVYQPCLSHIFNAFNEMEKDKDVSGDDFSSYKWRSTFMQSV
TDGYDKQNAEMPVLGYPEGTFLSKEILQSGKGQFGKINMSDINYYGMSEEALKDYVREEFAAAKRDNGRVFLSHL
TSTTHHPFVLPEGEPYLPLSDDKKLNDLSHYVNTIGYVDHWLGQILQILEEEGVADETLLVAVGDHGLSLPENGG
VTPYYNGNVGNFHVPLVLSHPSLPAVDVNDAAASLSILPTILDLLVETGSLSSETKQAAQDLMHNYEGQSLLRPQ
RQASWETGESNWLFTVMNPGKATIAIRDAHRPDWRIIMPVIDDVEWRFTDTAKDPHEMEPVISFSFKPLLEKIER
KHGVEAAAWAETAAFKAQWWVKENNRRWRFAESK*
Coding >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA
Transcript >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA
Gene >Ophcf2|02228
ATGATCTATCGTCTCCTTGGCCGTCCTCAGGCTACGCCGCCTCCTCCCGGTCCGTCTCTCACAACCTCGGTCATC
CTCTACTTCTTCAACAGACGCGTCTTATCCATTTCTCGATATGCCTTCTCAATTGTCGCCGTGGCCGTTCTTGCG
GCCAAGCTGGTGCACATCTACGCCCACGTTGATGCCATTGCCTCGGATCTCCTTGGCTATGGCATGTCGTTCTTC
GCCCAGGACGTCTTCTTCCTCCTTATAATGCGCCTATTCCTCGACAACATTGCCTCACTCAACTTGCGTTCCTTA
CGGATCCTGGCCGTCTCGGTGGCTTCGTTCCTCCTCGCCGCGACGCTCTTCTTTGGCTCAGTCAGCATCTCCTTT
TTCGTCGTCACCGGAACCGAGCTCCGCTGGCGCAACGTCGGTGTGGCCGGCGATTCCGCTGCTTGGGGCATGCTG
CTCTCCGGGCTCTTCTCCTGCAGCGCCGTGGCTCTGACCATCCTCCTGGTGGCCTGGCCGGCCCAGGACGTGTGC
GCCAGCGTCTTCGACGCCATCTTGAACCTCGTTCGATGGCCATTGAGCTTCGTCATGAGCAAGATTTCTCCCCGA
GCTGCGATCCTTCCCCTCGCCTACCAGCATGTGCCGCAAGACGACGAGGATTCCTCCGGTGAACGCAAGCTCCTG
ACGGCCGAGGATGTTCAGAAGGAAACTTCTCCCGCTGCCGAAGATCAGGCCCATCACCGGCCGTCATTGTGCCTA
CATGTCAGCCTCGCCATCACCATCATCATCATGGCCATTTCGAGCCTTGCACGGCCCGTCGACAGCTCTCTCATC
TTCATGTCGTGGACGCTACCCCTGGTGCCCTTCATCGACCTGCTGCCTTCGTCGCCCAGCGTGGCCGGCCTCGTT
CCCTCGTACGGCACCGATGTCAACAGCGATCTGGAGAACCGTACAGCGCTCGCGGAACCCCCGAGTTGGCCCTGG
CTGCCGGCTGGTAAGGCGCTGCCGGGCTTTGAGGACTGGTACGAGGGCAAGGATCACTACCGCGCCGAGAAGGAC
CCCCTTCGCGTCTCCAACCTCGACTCGGCCCTGCTGCCGGAGCTCAGACACAGCCTCGGCGGCGTCAAGATCCGT
CACGTCGTCCTCATCAAGCTCGAGAGCACCCGTAAGGACGTTTTCCCCATCAAGAAGGGAGGCTACATCTGGGAG
ACGCTCGCGGCCAGCCACGACAACCACACGTTGCCCAGCAGCGCCGTCGAGCTCTTTTCAAAGCTCACGCCCAAC
GCCAACTACCTGACGGGAGACTTTGATGACGGCTTCGACCACACCGAGAGGAAGCCGCGCGGCGGCATCAACGCC
AACAACGTCCACACCACCAGCACCTATACTCTCAAGAGCTTGGCCGGAACCCTGTGCGGCTTGTATCCGCTGGTG
GCCGACTTTAACCGCGAGTACGAGATGCATGTGTATCAGCCGTGTTTGTCGCACATCTTTAACGCCTTTAACGAG
ATGGAAAAGGACAAGGACGTCTCGGGCGACGACTTTAGCTCTTACAAGTGGAGGTCGACGTTTATGCAGTCCGTC
ACCGACGGCTACGACAAGCAGAACGCTGAGATGCCAGTGCTTGGATATCCCGAGGGCACATTTTTGAGCAAGGAG
ATCTTGCAGAGCGGCAAGGGTCAGTTTGGTAAGATTAACATGTCTGACATCAACTACTACGGCATGTCGGAGGAG
GCTCTCAAGGACTACGTTCGCGAGGAGTTTGCGGCAGCCAAGAGGGACAACGGACGAGTGTTCCTATCGCATCTC
ACCAGCACGACGCACCATCCGTTCGTCCTGCCCGAAGGGGAGCCATACCTACCGCTCTCAGACGACAAGAAGCTC
AACGACCTATCGCACTACGTCAACACGATCGGCTACGTCGACCACTGGCTCGGTCAGATTCTCCAGATTCTCGAG
GAGGAGGGCGTTGCCGACGAGACGCTGCTCGTGGCTGTCGGTGACCATGGCCTCTCGCTGCCCGAGAACGGGGGG
GTGACGCCCTATTACAACGGAAACGTGGGCAACTTTCACGTGCCTCTGGTGCTCTCTCACCCGTCTCTGCCGGCC
GTTGATGTCAACGACGCGGCGGCTTCTCTCTCGATCCTGCCGACTATCCTAGACCTGCTGGTAGAAACGGGCTCC
CTCTCATCCGAGACGAAACAGGCGGCGCAGGACCTGATGCATAACTACGAAGGCCAGTCGCTGCTCCGGCCTCAG
CGCCAGGCTTCGTGGGAGACGGGCGAGTCCAACTGGCTGTTTACGGTGATGAACCCGGGCAAGGCCACCATCGCC
ATCCGCGACGCTCACCGGCCGGACTGGCGGATCATCATGCCCGTGATCGACGACGTCGAGTGGCGTTTCACGGAT
ACGGCTAAGGATCCGCACGAGATGGAGCCCGTCATCTCCTTTTCCTTTAAGCCCCTGCTGGAAAAGATTGAACGA
AAGCACGGGGTCGAGGCTGCGGCGTGGGCCGAGACGGCGGCTTTTAAGGCTCAGTGGTGGGTCAAGGAGAATAAC
AGGAGGTGGCGTTTCGCGGAATCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail