Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02222
Gene name
Locationscaffold_02:2955329..2956991
Strand+
Gene length (bp)1662
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1643 0.086 0.8803 0.1698 0.0767 0.0365 0.1846 0.314 0.1947 0.0087

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.553191

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup121
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1029
Ophiocordyceps australis map64 (Brazil) OphauB2|161
Ophiocordyceps camponoti-floridani Ophcf2|02222 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2938
Ophiocordyceps kimflemingae Ophio5|3458
Ophiocordyceps subramaniannii Hirsu2|10002
Ophiocordyceps subramaniannii Hirsu2|23
Ophiocordyceps subramaniannii Hirsu2|431
Ophiocordyceps subramaniannii Hirsu2|4496
Ophiocordyceps subramaniannii Hirsu2|5356
Ophiocordyceps subramaniannii Hirsu2|8076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02222
MLHPLLPLILTVNAALGSMITHDHPVAQHFLSTLLGNINLDWSTPPTSETNQMSEKSCGMWIFKCARTLFKTKKT
LVKRYPPLPGGWQMVEYRPNITAYFIPRLERGIMNLGDDDISFAADESTSTVDSTTEGWQIGAQISSSLGLSVSA
SFSKSQSAGTSQTKGVSIQTTCRAGYDCRIETWTYHLRITGYCQLRPVIDCDGEINPCQPNMGLMCDQYFDFRQR
HCLGCGSASPFFHEKCQVQTPILDPAGRPFSRLVRISEKISEWSDEGLDGQQPPEKAIKFEDGLYQLETGEWYDD
TDQTYYGNLDDNWYHKPGLPRPDLSLGAAVRRVCKSLPCHRELAQLAGGRRLIPSECERHRKVPDLTYRVEDIFF
PWTPTCGRTTSKLRLQASDFSSVCNCVKEKRDGHGDACPDCKTSSCYRELIHMYGGSVDMLKRQCQHGELSKPEP
RFYDVPNYPFDSYCGQVINYLHFQVDDFKSICECVEANHALHQAKASASQAEQRADVSRSRVGHSKRQESDNPKM
PSRSQKKKKTIWKGGAEVEIEFLDEAPI*
Coding >Ophcf2|02222
ATGCTCCATCCTCTCCTCCCCCTAATCCTCACAGTCAACGCCGCCCTCGGCAGCATGATCACCCACGACCATCCC
GTAGCCCAGCACTTCCTCTCGACGCTTCTCGGAAACATCAACCTCGACTGGAGCACGCCCCCGACCAGCGAAACA
AACCAAATGAGCGAAAAGTCATGCGGCATGTGGATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGATATCCTCCCCTCCCTGGCGGCTGGCAGATGGTCGAGTACCGGCCCAACATCACGGCCTACTTC
ATCCCGCGCCTGGAGAGGGGAATCATGAATCTGGGTGATGATGACATCTCTTTTGCAGCCGACGAGTCGACTTCG
ACAGTCGACAGCACCACCGAGGGATGGCAGATTGGCGCCCAGATCTCCAGCAGTCTCGGTCTCTCCGTCTCGGCC
AGCTTCTCCAAGAGTCAGAGCGCAGGCACCAGCCAGACAAAGGGCGTGTCGATACAGACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACCTATCACCTTCGCATCACGGGATACTGCCAGCTGCGACCCGTAATCGAC
TGCGACGGCGAGATCAACCCGTGTCAGCCCAACATGGGCCTCATGTGCGATCAGTACTTCGACTTTCGACAGCGT
CACTGTCTCGGCTGCGGCTCGGCTTCGCCCTTTTTCCACGAAAAGTGTCAGGTGCAGACTCCCATCCTAGATCCA
GCTGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATATCGGAGTGGTCCGACGAAGGGCTGGATGGT
CAGCAGCCGCCTGAAAAGGCCATCAAGTTCGAAGACGGCCTGTACCAGCTCGAGACGGGCGAGTGGTACGACGAC
ACGGATCAGACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCGGGCCTCCCCAGGCCGGATCTCTCG
CTCGGGGCTGCCGTCCGTCGCGTCTGCAAGAGTCTCCCTTGTCACCGCGAGTTGGCACAACTGGCGGGCGGCAGG
AGGCTCATCCCTTCAGAATGCGAGCGTCACCGGAAAGTGCCAGATCTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTGGACTCCCACCTGCGGGCGGACGACGTCAAAGCTCCGGCTGCAAGCTTCCGACTTTTCGAGCGTGTGCAAC
TGCGTCAAGGAGAAGAGGGATGGCCATGGCGATGCTTGCCCTGATTGCAAGACGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTAAAGAGGCAGTGTCAGCACGGCGAATTGAGCAAGCCAGAGCCG
AGATTCTATGATGTTCCCAACTATCCATTCGATTCCTACTGCGGTCAGGTCATCAATTACCTTCATTTTCAGGTG
GACGACTTCAAGTCGATATGCGAATGCGTCGAGGCCAATCACGCTCTCCATCAGGCCAAGGCATCTGCTTCTCAG
GCCGAACAAAGAGCCGACGTCTCCCGCTCTCGAGTCGGCCATTCAAAGCGGCAAGAGTCGGACAATCCCAAGATG
CCATCTCGGTCACAGAAGAAGAAGAAGACGATATGGAAAGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAG
GCGCCCATTTGA
Transcript >Ophcf2|02222
ATGCTCCATCCTCTCCTCCCCCTAATCCTCACAGTCAACGCCGCCCTCGGCAGCATGATCACCCACGACCATCCC
GTAGCCCAGCACTTCCTCTCGACGCTTCTCGGAAACATCAACCTCGACTGGAGCACGCCCCCGACCAGCGAAACA
AACCAAATGAGCGAAAAGTCATGCGGCATGTGGATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGATATCCTCCCCTCCCTGGCGGCTGGCAGATGGTCGAGTACCGGCCCAACATCACGGCCTACTTC
ATCCCGCGCCTGGAGAGGGGAATCATGAATCTGGGTGATGATGACATCTCTTTTGCAGCCGACGAGTCGACTTCG
ACAGTCGACAGCACCACCGAGGGATGGCAGATTGGCGCCCAGATCTCCAGCAGTCTCGGTCTCTCCGTCTCGGCC
AGCTTCTCCAAGAGTCAGAGCGCAGGCACCAGCCAGACAAAGGGCGTGTCGATACAGACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACCTATCACCTTCGCATCACGGGATACTGCCAGCTGCGACCCGTAATCGAC
TGCGACGGCGAGATCAACCCGTGTCAGCCCAACATGGGCCTCATGTGCGATCAGTACTTCGACTTTCGACAGCGT
CACTGTCTCGGCTGCGGCTCGGCTTCGCCCTTTTTCCACGAAAAGTGTCAGGTGCAGACTCCCATCCTAGATCCA
GCTGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATATCGGAGTGGTCCGACGAAGGGCTGGATGGT
CAGCAGCCGCCTGAAAAGGCCATCAAGTTCGAAGACGGCCTGTACCAGCTCGAGACGGGCGAGTGGTACGACGAC
ACGGATCAGACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCGGGCCTCCCCAGGCCGGATCTCTCG
CTCGGGGCTGCCGTCCGTCGCGTCTGCAAGAGTCTCCCTTGTCACCGCGAGTTGGCACAACTGGCGGGCGGCAGG
AGGCTCATCCCTTCAGAATGCGAGCGTCACCGGAAAGTGCCAGATCTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTGGACTCCCACCTGCGGGCGGACGACGTCAAAGCTCCGGCTGCAAGCTTCCGACTTTTCGAGCGTGTGCAAC
TGCGTCAAGGAGAAGAGGGATGGCCATGGCGATGCTTGCCCTGATTGCAAGACGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTAAAGAGGCAGTGTCAGCACGGCGAATTGAGCAAGCCAGAGCCG
AGATTCTATGATGTTCCCAACTATCCATTCGATTCCTACTGCGGTCAGGTCATCAATTACCTTCATTTTCAGGTG
GACGACTTCAAGTCGATATGCGAATGCGTCGAGGCCAATCACGCTCTCCATCAGGCCAAGGCATCTGCTTCTCAG
GCCGAACAAAGAGCCGACGTCTCCCGCTCTCGAGTCGGCCATTCAAAGCGGCAAGAGTCGGACAATCCCAAGATG
CCATCTCGGTCACAGAAGAAGAAGAAGACGATATGGAAAGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAG
GCGCCCATTTGA
Gene >Ophcf2|02222
ATGCTCCATCCTCTCCTCCCCCTAATCCTCACAGTCAACGCCGCCCTCGGCAGCATGATCACCCACGACCATCCC
GTAGCCCAGCACTTCCTCTCGACGCTTCTCGGAAACATCAACCTCGACTGGAGCACGCCCCCGACCAGCGAAACA
AACCAAATGAGCGAAAAGTCATGCGGCATGTGGATCTTCAAATGCGCCAGGACGCTGTTCAAGACCAAGAAGACG
CTGGTCAAGAGATATCCTCCCCTCCCTGGCGGCTGGCAGATGGTCGAGTACCGGCCCAACATCACGGCCTACTTC
ATCCCGCGCCTGGAGAGGGGAATCATGAATCTGGGTGATGATGACATCTCTTTTGCAGCCGACGAGTCGACTTCG
ACAGTCGACAGCACCACCGAGGGATGGCAGATTGGCGCCCAGATCTCCAGCAGTCTCGGTCTCTCCGTCTCGGCC
AGCTTCTCCAAGAGTCAGAGCGCAGGCACCAGCCAGACAAAGGGCGTGTCGATACAGACAACCTGCCGCGCTGGA
TATGACTGCCGTATCGAGACGTGGACCTATCACCTTCGCATCACGGGATACTGCCAGCTGCGACCCGTAATCGAC
TGCGACGGCGAGATCAACCCGTGTCAGCCCAACATGGGCCTCATGTGCGATCAGTACTTCGACTTTCGACAGCGT
CACTGTCTCGGCTGCGGCTCGGCTTCGCCCTTTTTCCACGAAAAGTGTCAGGTGCAGACTCCCATCCTAGATCCA
GCTGGCCGGCCCTTTTCACGCCTCGTCCGTATCTCGGAGAAGATATCGGAGTGGTCCGACGAAGGGCTGGATGGT
CAGCAGCCGCCTGAAAAGGCCATCAAGTTCGAAGACGGCCTGTACCAGCTCGAGACGGGCGAGTGGTACGACGAC
ACGGATCAGACCTACTACGGAAACCTCGACGACAACTGGTATCACAAGCCGGGCCTCCCCAGGCCGGATCTCTCG
CTCGGGGCTGCCGTCCGTCGCGTCTGCAAGAGTCTCCCTTGTCACCGCGAGTTGGCACAACTGGCGGGCGGCAGG
AGGCTCATCCCTTCAGAATGCGAGCGTCACCGGAAAGTGCCAGATCTGACGTATCGCGTCGAGGACATCTTCTTC
CCCTGGACTCCCACCTGCGGGCGGACGACGTCAAAGCTCCGGCTGCAAGCTTCCGACTTTTCGAGCGTGTGCAAC
TGCGTCAAGGAGAAGAGGGATGGCCATGGCGATGCTTGCCCTGATTGCAAGACGTCGAGCTGCTATCGAGAGCTC
ATCCACATGTACGGCGGCTCCGTCGACATGCTAAAGAGGCAGTGTCAGCACGGCGAATTGAGCAAGCCAGAGCCG
AGATTCTATGATGTTCCCAACTATCCATTCGATTCCTACTGCGGTCAGGTCATCAATTACCTTCATTTTCAGGTG
GACGACTTCAAGTCGATATGCGAATGCGTCGAGGCCAATCACGCTCTCCATCAGGCCAAGGCATCTGCTTCTCAG
GCCGAACAAAGAGCCGACGTCTCCCGCTCTCGAGTCGGCCATTCAAAGCGGCAAGAGTCGGACAATCCCAAGATG
CCATCTCGGTCACAGAAGAAGAAGAAGACGATATGGAAAGGGGGAGCTGAAGTCGAGATTGAGTTTCTGGACGAG
GCGCCCATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail