Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02213
Gene name
Locationscaffold_02:2928711..2930521
Strand-
Gene length (bp)1810
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 1.4E-37 298 554

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 103 120 17
2 140 162 22
3 182 201 19
4 206 228 22
5 343 365 22
6 404 426 22
7 533 555 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 31.19 16.93 45.44
Alive In ants, during behavior modification 54.24 30.55 77.93
Dead In ants, recently dead 66.53 38.10 94.96

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.002287 yes
Alive Dead 0.220474 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02213
MPAPARPPANGTGNDHHVLRPRSRKRLSRRASGPDSEADVPSGMTSGRSTPLPENAPPSAKSLSSARRHARAEQR
RRLFPTVEFAERLSHFDPASDYRDFHGFFNLFWIGLAIMGITTMLRNFKDTGYPLRIQIWSLFTVKLWHLAVADF
LMVATTAISLPLHRRARSSRGFWTWKRAGMVVQSLYQLAWLVFWIGVPFWFEWTWTAQVFMLLHTMVLLMKMHSY
AFYNGHLAEAEKRLRALDNPGSTTAAAVRAPAYQYPSVDLCPGGVSGIPGPARPSKKTDDDDAQQDDVHLLRETL
ARELTSPMGNVTYPHNLTWHNYLDYLLCPTLCYELEYPRTTSVNWTSLISKIVATFGCIFLLTVTSEEYILPVLV
DASRRLDAVRASSSSSSESLLILAESISWLLFPFMLTFLLVFLVIFEYVLGAFAEITRFADRHFYADWWNSTDWL
EFSREWNVPVYSFLRRHVYGASRPHTGKMAATVITFLISAAGHEIIMACITKKIRGYGFVCMMLQLPIMMLQRTR
CVRGRQTLNNVCFWCSMIIGLSMMCALYVLV*
Coding >Ophcf2|02213
ATGCCGGCTCCGGCCCGTCCGCCGGCCAACGGCACCGGCAACGATCATCATGTCCTCCGCCCGCGCTCGAGAAAG
AGACTCTCCCGCCGAGCCTCAGGTCCGGACTCGGAAGCAGACGTGCCCAGCGGCATGACCAGCGGCCGCTCTACT
CCCCTCCCCGAAAATGCGCCCCCCTCGGCAAAGTCCCTCTCGTCCGCCCGTAGGCACGCCCGCGCCGAGCAGCGA
CGACGCCTCTTCCCGACTGTCGAGTTCGCCGAACGCCTCTCCCACTTCGACCCTGCCAGCGACTACCGCGACTTC
CATGGCTTCTTCAACCTCTTCTGGATCGGCCTCGCCATCATGGGCATCACCACCATGCTACGCAACTTCAAAGAC
ACGGGCTATCCTCTCCGTATCCAGATCTGGTCCCTCTTCACCGTCAAGCTGTGGCACCTCGCCGTCGCCGACTTC
CTCATGGTCGCCACCACCGCCATCAGCCTCCCGCTCCATCGCCGAGCCAGATCCTCTCGCGGCTTCTGGACCTGG
AAGCGGGCCGGCATGGTGGTCCAGAGCCTGTACCAGCTCGCCTGGCTCGTCTTCTGGATCGGAGTCCCCTTCTGG
TTCGAGTGGACCTGGACGGCCCAAGTCTTCATGCTTCTGCACACAATGGTCCTCCTCATGAAGATGCATTCCTAC
GCCTTCTACAACGGCCACCTCGCCGAGGCCGAGAAGCGACTCCGCGCCCTCGACAACCCGGGATCCACCACCGCC
GCCGCCGTCCGCGCTCCGGCCTACCAGTACCCCTCCGTCGACCTCTGCCCCGGCGGCGTCTCCGGCATCCCCGGC
CCCGCCCGTCCGTCCAAGAAGACCGATGACGATGACGCCCAGCAAGACGACGTCCATCTCCTCCGCGAGACCCTC
GCCCGCGAGCTCACCAGCCCCATGGGCAACGTCACCTACCCTCACAACCTCACATGGCACAACTACCTCGACTAC
CTGCTCTGTCCGACGCTCTGCTACGAGCTCGAATACCCACGCACCACCTCGGTCAACTGGACCTCGCTCATCTCC
AAGATCGTCGCCACCTTTGGCTGCATCTTCCTCCTCACCGTAACATCAGAAGAGTACATCCTGCCCGTCCTCGTC
GACGCCTCACGCCGCCTCGACGCCGTCCGCGCCTCCTCGTCATCGTCCTCCGAGTCTCTCCTCATCCTGGCCGAG
AGCATCTCCTGGCTCCTCTTCCCCTTCATGCTCACCTTCCTCCTCGTCTTCCTCGTCATCTTCGAGTACGTCCTG
GGCGCCTTTGCCGAAATCACCCGCTTCGCCGATCGTCACTTCTACGCCGACTGGTGGAATTCGACCGACTGGCTC
GAGTTCTCGCGCGAGTGGAACGTCCCCGTCTACTCCTTTCTCCGACGCCACGTCTACGGTGCCTCACGCCCGCAC
ACGGGGAAGATGGCCGCCACCGTCATCACCTTTCTCATCTCCGCCGCCGGCCACGAGATCATCATGGCCTGCATC
ACCAAGAAGATCCGCGGCTATGGCTTCGTATGCATGATGCTCCAGCTGCCCATCATGATGCTGCAGCGCACCCGC
TGCGTCCGCGGCCGCCAGACGCTCAACAATGTCTGCTTCTGGTGCTCCATGATCATCGGTCTCAGCATGATGTGC
GCCCTGTATGTGCTTGTCTAG
Transcript >Ophcf2|02213
ATGCCGGCTCCGGCCCGTCCGCCGGCCAACGGCACCGGCAACGATCATCATGTCCTCCGCCCGCGCTCGAGAAAG
AGACTCTCCCGCCGAGCCTCAGGTCCGGACTCGGAAGCAGACGTGCCCAGCGGCATGACCAGCGGCCGCTCTACT
CCCCTCCCCGAAAATGCGCCCCCCTCGGCAAAGTCCCTCTCGTCCGCCCGTAGGCACGCCCGCGCCGAGCAGCGA
CGACGCCTCTTCCCGACTGTCGAGTTCGCCGAACGCCTCTCCCACTTCGACCCTGCCAGCGACTACCGCGACTTC
CATGGCTTCTTCAACCTCTTCTGGATCGGCCTCGCCATCATGGGCATCACCACCATGCTACGCAACTTCAAAGAC
ACGGGCTATCCTCTCCGTATCCAGATCTGGTCCCTCTTCACCGTCAAGCTGTGGCACCTCGCCGTCGCCGACTTC
CTCATGGTCGCCACCACCGCCATCAGCCTCCCGCTCCATCGCCGAGCCAGATCCTCTCGCGGCTTCTGGACCTGG
AAGCGGGCCGGCATGGTGGTCCAGAGCCTGTACCAGCTCGCCTGGCTCGTCTTCTGGATCGGAGTCCCCTTCTGG
TTCGAGTGGACCTGGACGGCCCAAGTCTTCATGCTTCTGCACACAATGGTCCTCCTCATGAAGATGCATTCCTAC
GCCTTCTACAACGGCCACCTCGCCGAGGCCGAGAAGCGACTCCGCGCCCTCGACAACCCGGGATCCACCACCGCC
GCCGCCGTCCGCGCTCCGGCCTACCAGTACCCCTCCGTCGACCTCTGCCCCGGCGGCGTCTCCGGCATCCCCGGC
CCCGCCCGTCCGTCCAAGAAGACCGATGACGATGACGCCCAGCAAGACGACGTCCATCTCCTCCGCGAGACCCTC
GCCCGCGAGCTCACCAGCCCCATGGGCAACGTCACCTACCCTCACAACCTCACATGGCACAACTACCTCGACTAC
CTGCTCTGTCCGACGCTCTGCTACGAGCTCGAATACCCACGCACCACCTCGGTCAACTGGACCTCGCTCATCTCC
AAGATCGTCGCCACCTTTGGCTGCATCTTCCTCCTCACCGTAACATCAGAAGAGTACATCCTGCCCGTCCTCGTC
GACGCCTCACGCCGCCTCGACGCCGTCCGCGCCTCCTCGTCATCGTCCTCCGAGTCTCTCCTCATCCTGGCCGAG
AGCATCTCCTGGCTCCTCTTCCCCTTCATGCTCACCTTCCTCCTCGTCTTCCTCGTCATCTTCGAGTACGTCCTG
GGCGCCTTTGCCGAAATCACCCGCTTCGCCGATCGTCACTTCTACGCCGACTGGTGGAATTCGACCGACTGGCTC
GAGTTCTCGCGCGAGTGGAACGTCCCCGTCTACTCCTTTCTCCGACGCCACGTCTACGGTGCCTCACGCCCGCAC
ACGGGGAAGATGGCCGCCACCGTCATCACCTTTCTCATCTCCGCCGCCGGCCACGAGATCATCATGGCCTGCATC
ACCAAGAAGATCCGCGGCTATGGCTTCGTATGCATGATGCTCCAGCTGCCCATCATGATGCTGCAGCGCACCCGC
TGCGTCCGCGGCCGCCAGACGCTCAACAATGTCTGCTTCTGGTGCTCCATGATCATCGGTCTCAGCATGATGTGC
GCCCTGTATGTGCTTGTCTAG
Gene >Ophcf2|02213
ATGCCGGCTCCGGCCCGTCCGCCGGCCAACGGCACCGGCAACGATCATCATGTCCTCCGCCCGCGCTCGAGAAAG
AGACTCTCCCGCCGAGCCTCAGGTCCGGACTCGGAAGCAGACGTGCCCAGCGGCATGACCAGGTCCGTTTCAGTC
TCTTACTCCCCACCCCATCCCATCATCTCTCTCTATACATACTGAACCAGTCCCGTCTTCCTCTTTCCCCCAGCG
GCCGCTCTACTCCCCTCCCCGAAAATGCGCCCCCCTCGGCAAAGTCCCTCTCGTCCGCCCGTAGGCACGCCCGCG
CCGAGCAGCGACGACGCCTCTTCCCGACTGTCGAGTTCGCCGAACGCCTCTCCCACTTCGACCCTGCCAGCGACT
ACCGCGACTTCCATGGCTTCTTCAACCTCTTCTGGATCGGCCTCGCCATCATGGGCATCACCACCATGCTACGCA
ACTTCAAAGACACGGGCTATCCTCTCCGTATCCAGATCTGGTCCCTCTTCACCGTCAAGCTGTGGCACCTCGCCG
TCGCCGACTTCCTCATGGTCGCCACCACCGCCATCAGCCTCCCGCTCCATCGCCGAGCCAGATCCTCTCGCGGCT
TCTGGACCTGGAAGCGGGCCGGCATGGTGGTCCAGAGCCTGTACCAGCTCGCCTGGCTCGTCTTCTGGATCGGAG
TCCCCTTCTGGTTCGAGTGGACCTGGACGGCCCAAGTCTTCATGCTTCTGCACACAATGGTCCTCCTCATGAAGA
TGCATTCCTACGCCTTCTACAACGGCCACCTCGCCGAGGCCGAGAAGCGACTCCGCGCCCTCGACAACCCGGGAT
CCACCACCGCCGCCGCCGTCCGCGCTCCGGCCTACCAGTACCCCTCCGTCGACCTCTGCCCCGGCGGCGTCTCCG
GCATCCCCGGCCCCGCCCGTCCGTCCAAGAAGACCGATGACGATGACGCCCAGCAAGACGACGTCCATCTCCTCC
GCGAGACCCTCGCCCGCGAGCTCACCAGCCCCATGGGCAACGTCACCTACCCTCACAACCTCACATGGCACAACT
ACCTCGACTACCTGCTCTGTCCGACGCTCTGCTACGAGCTCGAATACCCACGCACCACCTCGGTCAACTGGACCT
CGCTCATCTCCAAGATCGTCGCCACCTTTGGCTGCATCTTCCTCCTCACCGTAACATCAGAAGAGTACATCCTGC
CCGTCCTCGTCGACGCCTCACGCCGCCTCGACGCCGTCCGCGCCTCCTCGTCATCGTCCTCCGAGTCTCTCCTCA
TCCTGGCCGAGAGCATCTCCTGGCTCCTCTTCCCCTTCATGCTCACCTTCCTCCTCGTCTTCCTCGTCATCTTCG
AGTACGTCCTGGGCGCCTTTGCCGAAATCACCCGCTTCGCCGATCGTCACTTCTACGCCGACTGGTGGAATTCGA
CCGACTGGCTCGAGTTCTCGCGCGAGTGGAACGTCCCCGTCTACTCCTTTCTCCGACGCCACGTCTACGGTGCCT
CACGCCCGCACACGGGGAAGATGGCCGCCACCGTCATCACCTTTCTCATCTCCGCCGCCGGCCACGAGATCATCA
TGGCCTGCATCACCAAGAAGATCCGCGGCTATGGCTTCGTATGCATGATGCTCCAGCTGCCCATCATGATGCTGC
AGCGCACCCGCTGCGTCCGCGGCCGCCAGACGCTCAACAATGTCTGCTTCTGGTGCTCCATGATCATCGGTCTCA
GCATGGTATGTTGATGGGCCGTCTCCGAGCCGCCGTGTTCGTCGCTGACCTTGACCAGATGTGCGCCCTGTATGT
GCTTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail