Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02212
Gene name
Locationscaffold_02:2924788..2928221
Strand+
Gene length (bp)3433
Transcript length (bp)2334
Coding sequence length (bp)2334
Protein length (aa) 778

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00183 HSP90 Hsp90 protein 1.8E-218 255 763
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.9E-15 98 252
PF01613 Flavin_Reduct Flavin reductase like domain 8.0E-10 1 45
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.3E-08 97 217

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0051082 unfolded protein binding Yes
GO:0010181 FMN binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0006457 protein folding Yes
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0005515 protein binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5069 0.48 0.1635 0.1471 0.1848 0.1152 0.3434 0.1399 0.1622 0.0638

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1493
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4758
Ophiocordyceps australis map64 (Brazil) OphauB2|955
Ophiocordyceps camponoti-floridani Ophcf2|02212 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2397
Ophiocordyceps kimflemingae Ophio5|3171
Ophiocordyceps subramaniannii Hirsu2|11130

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02212
MTMSSLTSLSLSPTPLVTFNVATPSRTLDAMAGSGRFNMHILTGDTAGAERLPSPSPHLPQYLQPHLLPDIVAMA
ETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYKALSDPSQLDTGKDLRIDIIPDLEKKTLTIR
DTGIGMTKADLVNNLGTIARSGTKQFMEALTAGADVSMIGQFGVGFYSAYLVADRVSVVSKHNDDEQYIWESSAG
GTFSISADTEGNQLGRGTAIILHLKEEQSEYLNESKIKEVIKKHSEFISYPIYLHVKKETEKEVPDEDADEEVKD
ADEGDEKKPRIEEVDDEDEEKEKKKKTKKIKETKIEEEELNKQKPIWTRNPQDINQDEYASFYKSLSNDWEDHLA
VKHFSVEGQLEFRAILFVPKRAPFDLFETKKTKNNIKLYVRRVFITDDATDLIPEWLGFIKGVVDSEDLPLNLSR
ETLQQNKIMKVIKKNIVKKSLELFTEIAEDKEQFDKFYSAFSKNLKLGIHEDSQNRQTLAKLLRFNSTKSGDEMT
SLSDYVTRMPEHQKNMYYITGESIKAVSKSPFLDTLKDKGFEVLFLVDPIDEYAMTQLKEFEGKKLVDITKDFEL
EETDEEKAAREKEEKEYESLAKCLKNILGDKVEKVVVSYKLGSSPCAIRTGQFGWSANMERIMKAQALRDTSMSS
YMSSKKTFEISPKSIIIQELKRKVEADGENDRPLKSIVQLLFETSLLVSGFTIDDPAGFAERTHKLVQLGLNIDE
DDTAAAEAPAAEAPAAATGDSAMEEVD*
Coding >Ophcf2|02212
ATGACCATGTCATCGCTTACAAGCTTATCGCTCTCGCCAACGCCGCTGGTGACCTTTAACGTGGCGACGCCCAGC
CGGACGTTGGACGCCATGGCGGGGAGCGGACGCTTCAACATGCATATCCTTACGGGGGACACAGCAGGTGCCGAG
AGGCTCCCGTCTCCATCACCACATCTTCCGCAATACTTGCAGCCTCACCTTCTTCCTGATATCGTCGCCATGGCC
GAGACTTTCGAGTTTCAGGCTGAGATTTCTCAGCTGTTGTCCCTCATCATCAACACCGTCTACTCCAACAAGGAA
ATCTTCCTTCGTGAACTCATCTCCAATGCCTCGGATGCCCTGGACAAGATCCGCTACAAGGCGTTGTCGGACCCC
AGCCAGCTCGACACGGGCAAGGACCTCCGCATCGACATCATCCCGGACTTGGAGAAGAAGACGTTGACGATCCGC
GATACTGGTATTGGCATGACCAAGGCCGATCTGGTCAATAACCTGGGAACCATTGCCCGCTCTGGCACCAAGCAG
TTCATGGAGGCCCTCACTGCCGGTGCCGACGTTTCCATGATTGGCCAGTTCGGTGTCGGCTTCTACTCGGCCTAC
CTCGTTGCCGACCGTGTCAGCGTCGTCTCCAAGCACAACGATGACGAGCAGTACATCTGGGAGTCGAGCGCTGGC
GGCACCTTTAGCATCTCGGCCGATACCGAGGGCAACCAGCTCGGTCGCGGCACTGCCATCATCCTGCACCTGAAA
GAGGAGCAGTCCGAGTACCTCAACGAGAGCAAGATCAAGGAGGTCATCAAGAAGCACTCCGAGTTCATCTCGTAC
CCCATCTACCTCCACGTCAAGAAGGAGACGGAGAAGGAGGTTCCCGACGAGGATGCCGACGAGGAAGTCAAGGAT
GCCGATGAGGGCGACGAGAAGAAGCCTCGCATCGAGGAGGTTGATGATGAGGACGAGGAAAAGGAGAAGAAAAAG
AAGACCAAGAAGATCAAGGAGACCAAGATCGAGGAGGAGGAGCTCAACAAGCAGAAGCCCATCTGGACTCGCAAC
CCCCAAGACATCAACCAGGACGAGTACGCCTCCTTCTACAAGTCGCTGTCCAACGACTGGGAAGACCACTTGGCC
GTCAAGCACTTCTCCGTGGAGGGTCAGCTCGAGTTCCGCGCCATCCTCTTCGTCCCCAAGCGCGCTCCCTTTGAC
CTGTTCGAAACCAAGAAGACCAAGAACAACATCAAGCTCTATGTCCGCCGCGTCTTCATCACGGACGATGCCACC
GACCTCATCCCAGAGTGGCTCGGCTTCATCAAGGGCGTCGTCGACTCCGAGGACTTGCCCCTCAACCTGTCGCGT
GAGACTCTGCAGCAGAACAAGATCATGAAGGTCATCAAGAAGAACATTGTCAAGAAGTCGCTCGAGCTCTTCACC
GAGATTGCCGAGGACAAGGAGCAGTTCGACAAGTTCTACAGCGCCTTCTCCAAGAACCTCAAGCTCGGCATTCAC
GAGGATTCGCAGAATCGTCAGACGCTGGCTAAGCTCCTGCGCTTCAACTCGACCAAGTCTGGCGACGAGATGACC
TCGCTCTCCGACTACGTCACCCGCATGCCTGAGCACCAGAAGAACATGTACTACATCACGGGCGAGTCCATCAAG
GCCGTCTCCAAGTCGCCCTTCCTCGACACGCTCAAGGACAAGGGTTTCGAGGTGCTGTTCCTCGTGGACCCCATT
GACGAGTACGCCATGACGCAGCTCAAGGAGTTTGAGGGTAAGAAGCTGGTGGACATCACCAAGGACTTTGAGCTC
GAGGAGACGGACGAGGAGAAGGCCGCCCGTGAGAAGGAGGAGAAGGAGTACGAGTCGCTGGCCAAATGCCTCAAG
AACATCCTCGGTGACAAGGTCGAGAAGGTGGTGGTCAGCTACAAGCTCGGCAGCTCTCCCTGCGCCATCCGTACC
GGCCAGTTCGGCTGGTCGGCCAACATGGAGCGCATCATGAAGGCTCAGGCGCTGCGCGACACGTCGATGAGCAGC
TACATGTCGTCCAAGAAGACGTTTGAGATTTCGCCCAAGTCGATCATCATCCAGGAGCTCAAGCGCAAGGTCGAG
GCCGACGGTGAGAACGACCGGCCGCTCAAGTCGATCGTGCAGCTGCTGTTCGAGACTTCGCTTCTCGTCTCGGGC
TTCACCATTGACGACCCGGCTGGCTTTGCCGAGCGCACCCACAAGCTCGTCCAGCTCGGTCTCAACATCGACGAG
GACGACACGGCAGCTGCAGAGGCGCCGGCTGCCGAGGCTCCGGCCGCGGCGACGGGCGACAGCGCCATGGAGGAG
GTCGACTGA
Transcript >Ophcf2|02212
ATGACCATGTCATCGCTTACAAGCTTATCGCTCTCGCCAACGCCGCTGGTGACCTTTAACGTGGCGACGCCCAGC
CGGACGTTGGACGCCATGGCGGGGAGCGGACGCTTCAACATGCATATCCTTACGGGGGACACAGCAGGTGCCGAG
AGGCTCCCGTCTCCATCACCACATCTTCCGCAATACTTGCAGCCTCACCTTCTTCCTGATATCGTCGCCATGGCC
GAGACTTTCGAGTTTCAGGCTGAGATTTCTCAGCTGTTGTCCCTCATCATCAACACCGTCTACTCCAACAAGGAA
ATCTTCCTTCGTGAACTCATCTCCAATGCCTCGGATGCCCTGGACAAGATCCGCTACAAGGCGTTGTCGGACCCC
AGCCAGCTCGACACGGGCAAGGACCTCCGCATCGACATCATCCCGGACTTGGAGAAGAAGACGTTGACGATCCGC
GATACTGGTATTGGCATGACCAAGGCCGATCTGGTCAATAACCTGGGAACCATTGCCCGCTCTGGCACCAAGCAG
TTCATGGAGGCCCTCACTGCCGGTGCCGACGTTTCCATGATTGGCCAGTTCGGTGTCGGCTTCTACTCGGCCTAC
CTCGTTGCCGACCGTGTCAGCGTCGTCTCCAAGCACAACGATGACGAGCAGTACATCTGGGAGTCGAGCGCTGGC
GGCACCTTTAGCATCTCGGCCGATACCGAGGGCAACCAGCTCGGTCGCGGCACTGCCATCATCCTGCACCTGAAA
GAGGAGCAGTCCGAGTACCTCAACGAGAGCAAGATCAAGGAGGTCATCAAGAAGCACTCCGAGTTCATCTCGTAC
CCCATCTACCTCCACGTCAAGAAGGAGACGGAGAAGGAGGTTCCCGACGAGGATGCCGACGAGGAAGTCAAGGAT
GCCGATGAGGGCGACGAGAAGAAGCCTCGCATCGAGGAGGTTGATGATGAGGACGAGGAAAAGGAGAAGAAAAAG
AAGACCAAGAAGATCAAGGAGACCAAGATCGAGGAGGAGGAGCTCAACAAGCAGAAGCCCATCTGGACTCGCAAC
CCCCAAGACATCAACCAGGACGAGTACGCCTCCTTCTACAAGTCGCTGTCCAACGACTGGGAAGACCACTTGGCC
GTCAAGCACTTCTCCGTGGAGGGTCAGCTCGAGTTCCGCGCCATCCTCTTCGTCCCCAAGCGCGCTCCCTTTGAC
CTGTTCGAAACCAAGAAGACCAAGAACAACATCAAGCTCTATGTCCGCCGCGTCTTCATCACGGACGATGCCACC
GACCTCATCCCAGAGTGGCTCGGCTTCATCAAGGGCGTCGTCGACTCCGAGGACTTGCCCCTCAACCTGTCGCGT
GAGACTCTGCAGCAGAACAAGATCATGAAGGTCATCAAGAAGAACATTGTCAAGAAGTCGCTCGAGCTCTTCACC
GAGATTGCCGAGGACAAGGAGCAGTTCGACAAGTTCTACAGCGCCTTCTCCAAGAACCTCAAGCTCGGCATTCAC
GAGGATTCGCAGAATCGTCAGACGCTGGCTAAGCTCCTGCGCTTCAACTCGACCAAGTCTGGCGACGAGATGACC
TCGCTCTCCGACTACGTCACCCGCATGCCTGAGCACCAGAAGAACATGTACTACATCACGGGCGAGTCCATCAAG
GCCGTCTCCAAGTCGCCCTTCCTCGACACGCTCAAGGACAAGGGTTTCGAGGTGCTGTTCCTCGTGGACCCCATT
GACGAGTACGCCATGACGCAGCTCAAGGAGTTTGAGGGTAAGAAGCTGGTGGACATCACCAAGGACTTTGAGCTC
GAGGAGACGGACGAGGAGAAGGCCGCCCGTGAGAAGGAGGAGAAGGAGTACGAGTCGCTGGCCAAATGCCTCAAG
AACATCCTCGGTGACAAGGTCGAGAAGGTGGTGGTCAGCTACAAGCTCGGCAGCTCTCCCTGCGCCATCCGTACC
GGCCAGTTCGGCTGGTCGGCCAACATGGAGCGCATCATGAAGGCTCAGGCGCTGCGCGACACGTCGATGAGCAGC
TACATGTCGTCCAAGAAGACGTTTGAGATTTCGCCCAAGTCGATCATCATCCAGGAGCTCAAGCGCAAGGTCGAG
GCCGACGGTGAGAACGACCGGCCGCTCAAGTCGATCGTGCAGCTGCTGTTCGAGACTTCGCTTCTCGTCTCGGGC
TTCACCATTGACGACCCGGCTGGCTTTGCCGAGCGCACCCACAAGCTCGTCCAGCTCGGTCTCAACATCGACGAG
GACGACACGGCAGCTGCAGAGGCGCCGGCTGCCGAGGCTCCGGCCGCGGCGACGGGCGACAGCGCCATGGAGGAG
GTCGACTGA
Gene >Ophcf2|02212
ATGACCATGTCATCGCTTACAAGCTTATCGCTCTCGCCAACGCCGCTGGTGACCTTTAACGTGGCGACGCCCAGC
CGGACGTTGGACGCCATGGCGGGGAGCGGACGCTTCAACATGCATATCCTTACGGGGGACACAGCAGGTGCCGAG
GTTGCGAGACATTTCACGCGCGGGAACAAGGACGGCGGTGGTGTTTTGGATGGCGTTGCGGGCTTGACGATGGTG
GCGGGCGAGGATGCGCCTCTGCTGCGCGGGGACGGCGTTATGCGTGTGTTGAAGTGCCGGGTGCTGAGTGAGGGA
CCTTCCGGGGGGTTCGTCAAGGTTAGAGACCATGTCGTCGTCATGGGCGAGGTGCTGGAGACGGTAGGGGCTGAG
AGAGGGGGTTTCGCGCTGGCGTATGCGGATCGAAGGTATAGGCGAGTCGGCGGCGAGATAGAGGATGGCGGTGAT
GAGAGTAGGGAGACGTAAGGAGGAGCCCGTATTTGCAATCACGGGAAGTTTACGGCACCGAGGCCATATCGACGA
GTCATCTATGAACTGATACGGGTATGAACTGATACAGGTCCCGAGCTGCAACTGGGAGGAGACTGGCTCTTGTGC
CGCCGATCGGATGCTGCGAGGTTCGAGCCTATGGTGCGGGCGTCCAATCGCAACTCAAGAGCTTCGCAGCCTCGT
AGCCTCGTTGGAAGGCTGTAGAAAGGTCCAGCAACAACGACCAACGAGAAGCGGTAGTTAGTTAGCCTCTAGGGC
TTCAGGCTGTGTGGGCTGGTGTTTTTCTTCCATCCACTTCCGTCCAGCAGCCAGCCCTGGGACCACCCGCTGTAG
GTCCACCCAGTGACCCGCTGTGGCAGGCGAAAGTGCCGCTGCGCTCTAGAAGGCTCCATCAAGCTCCAGCACCTC
CGGGAACCAATCAGCGTGCCGCTAGCCTGCCCGCTGCTGAGGAACAGAGCACAAGCCATAGAATCTCATGGAATC
TTGACTTCGCAGACCCTGTGTTTTATTTTAGTAGGCCACTCCTCCCCTTCGCGAGAAAATTTCTCTCTTCTTTTC
TTCTTCTTCTCAAGCTCCCGCCCTTTTGCACCCTCCCTCTTCTCCATCCTGTACCCTTCCACAGAGGCTCCCGTC
TCCATCACCACATCTTCCGCAATGTAAGTTCACCAAGCTCTTCTCTTGCTGCCTTTGCCGTTCTCCGGTGGTCAC
GGCTCTACACATCCCCATCACCTTTTCTGCTGCTTCCTTCATCGTCCTCCTGCAAACAAGAGACGTGGTCTGACC
ATTTGCAGACTTGCAGCCTCACCTTCTTCCTGATATCGTCGCCATGGCCGAGACTTTCGAGTTTCAGGCTGAGAT
TTCTCAGCTGTTGTCCCTCATCATCAACACCGTCTACTCCAACAAGGAAATCTTCCTTCGTGAACTCATCTCCAA
TGCCTCGGATGCCCTGGACAAGATCCGCTACAAGGCGTTGTCGGACCCCAGCCAGCTCGACACGGGCAAGGACCT
CCGCATCGACATCATCCCGGACTTGGAGAAGAAGACGTTGACGATCCGCGATACTGGTATTGGCATGACCAAGGC
CGATCTGGTCAATAACCTGGGAACCATTGCCCGCTCTGGCACCAAGCAGTTCATGGAGGCCCTCACTGCCGGTGC
CGACGTTTCCATGATTGGCCAGTTCGGTGTCGGCTTCTACTCGGCCTACCTCGTTGCCGACCGTGTCAGCGTCGT
CTCCAAGCACAACGATGACGAGCAGTACATCTGGGAGTCGAGCGCTGGCGGCACCTTTAGCATCTCGGCCGATAC
CGAGGGCAACCAGCTCGGTCGCGGCACTGCCATCATCCTGCACCTGAAAGAGGAGCAGTCCGAGTACCTCAACGA
GAGCAAGATCAAGGAGGTCATCAAGAAGCACTCCGAGTTCATCTCGTACCCCATCTACCTCCACGTCAAGAAGGA
GACGGAGAAGGAGGTTCCCGACGAGGATGCCGACGAGGAAGTCAAGGATGCCGATGAGGGCGACGAGAAGAAGCC
TCGCATCGAGGAGGTTGATGATGAGGACGAGGAAAAGGAGAAGAAAAAGAAGACCAAGAAGATCAAGGAGACCAA
GATCGAGGAGGAGGAGCTCAACAAGCAGAAGCCCATCTGGACTCGCAACCCCCAAGACATCAACCAGGACGAGTA
CGCCTCCTTCTACAAGTCGCTGTCCAACGACTGGGAAGACCACTTGGCCGTCAAGCACTTCTCCGTGGAGGGTCA
GCTCGAGTTCCGCGCCATCCTCTTCGTCCCCAAGCGCGCTCCCTTTGACCTGTTCGAAACCAAGAAGACCAAGAA
CAACATCAAGCTCTATGTCCGCCGCGTCTTCATCACGGACGATGCCACCGACCTCATCCCAGAGTGGCTCGGCTT
CATCAAGGGCGTCGTCGACTCCGAGGACTTGCCCCTCAACCTGTCGCGTGAGACTCTGCAGCAGAACAAGATCAT
GAAGGTCATCAAGAAGAACATTGTCAAGAAGTCGCTCGAGCTCTTCACCGAGATTGCCGAGGACAAGGAGCAGTT
CGACAAGTTCTACAGCGCCTTCTCCAAGAACCTCAAGCTCGGCATTCACGAGGATTCGCAGAATCGTCAGACGCT
GGCTAAGCTCCTGCGCTTCAACTCGACCAAGTCTGGCGACGAGATGACCTCGCTCTCCGACTACGTCACCCGCAT
GCCTGAGCACCAGAAGAACATGTACTACATCACGGGCGAGTCCATCAAGGCCGTCTCCAAGTCGCCCTTCCTCGA
CACGCTCAAGGACAAGGGTTTCGAGGTGCTGTTCCTCGTGGACCCCATTGACGAGTACGCCATGACGCAGCTCAA
GGAGTTTGAGGGTAAGAAGCTGGTGGACATCACCAAGGACTTTGAGCTCGAGGAGACGGACGAGGAGAAGGCCGC
CCGTGAGAAGGAGGAGAAGGAGTACGAGTCGCTGGCCAAATGCCTCAAGAACATCCTCGGTGACAAGGTCGAGAA
GGTGGTGGTCAGCTACAAGCTCGGCAGCTCTCCCTGCGCCATCCGTACCGGCCAGTTCGGCTGGTCGGCCAACAT
GGAGCGCATCATGAAGGCTCAGGCGCTGCGCGACACGTCGATGAGCAGCTACATGTCGTCCAAGAAGACGTTTGA
GATTTCGCCCAAGTCGATCATCATCCAGGAGCTCAAGCGCAAGGTCGAGGCCGACGGTGAGAACGACCGGCCGCT
CAAGTCGATCGTGCAGCTGCTGTTCGAGACTTCGCTTCTCGTCTCGGGCTTCACCATTGACGACCCGGCTGGCTT
TGCCGAGCGCACCCACAAGCTCGTCCAGCTCGGTCTCAACATCGACGAGGACGACACGGCAGCTGCAGAGGCGCC
GGCTGCCGAGGCTCCGGCCGCGGCGACGGGCGACAGCGCCATGGAGGAGGTCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail