Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02210
Gene name
Locationscaffold_02:2921585..2923379
Strand+
Gene length (bp)1794
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09325 Vps5 Vps5 C terminal like 9.8E-87 290 519
PF00787 PX PX domain 5.4E-21 188 266

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005543 phospholipid binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.3997 0.3117 0.0993 0.1571 0.0954 0.0078 0.1861 0.9109 0.5597 0.0244

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2580
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4761
Ophiocordyceps australis map64 (Brazil) OphauB2|958
Ophiocordyceps camponoti-floridani Ophcf2|02210 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2399
Ophiocordyceps kimflemingae Ophio5|3168
Ophiocordyceps subramaniannii Hirsu2|3869

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02210
MDVEESPWADSGHGSQPETSQNEAVSSQTSSQTAPTPAPRLSRGPRRLVAQPTRLEAVEDPLGPLSGGGDDDAPA
PARDTAPPVPPQKEQMVMRTTMAHHHQPVRRSTDPHDVDDAEFDSPKGPRAPPPVDAAMPSSVRSSSQPSVSIEQ
AAKPTFQITVGDPVKIGDLTSSHIVYSVRTKTTSRAYKQPEFEVKRRYRDFLWLYNTLHGNNPGCVVPPPPEKQA
VGRFNSNFVESRRAALEKMLSKTAAHPTLQHDADLKLFLESEAFNVDVKHKERRDPLPPENKGVFGSLGINVGGG
TKFVEQDDWFHDRKVYMDALENQLRGLLKAMDIMVSQRKLMAEAAAEFSASLHALSTVELSPSLSGPLDALSDLQ
LTIRDVYDRQAQQDVLTFGIIIDEYIRLIGSVKQAFNQRQKGFFAWHAAESELRKKKATQDKLLRQGKSQQDRLN
QYSAQVGEAEKKVHQARLLFEEMGRQIRSELERFEKEKVEDFKSGVETFLESAVEAQKELIEKWETFLMQMDAED
DDSSAFYWPPATQQKPPGDTAIDRARANMHDDSD*
Coding >Ophcf2|02210
ATGGACGTCGAAGAGTCGCCTTGGGCTGACTCGGGTCACGGTTCGCAGCCGGAAACCTCGCAGAATGAGGCCGTC
AGCAGTCAAACGTCGTCACAGACGGCTCCAACGCCAGCGCCTCGCCTTTCGCGCGGGCCTCGTCGCCTAGTCGCT
CAACCAACTCGTCTCGAGGCCGTCGAGGACCCTCTCGGCCCTCTGAGCGGTGGTGGTGACGATGATGCTCCTGCT
CCTGCTCGTGACACGGCGCCTCCTGTGCCGCCCCAAAAAGAGCAAATGGTCATGCGCACCACCATGGCTCACCAC
CACCAGCCCGTTCGCCGTTCCACGGACCCCCACGACGTCGACGACGCTGAATTCGACTCTCCCAAGGGCCCTAGG
GCTCCGCCTCCCGTCGATGCTGCGATGCCGAGCTCAGTCAGAAGCAGTTCTCAGCCTAGCGTCAGCATCGAGCAG
GCGGCCAAGCCCACGTTTCAAATCACTGTTGGCGATCCCGTCAAGATTGGCGACTTGACCAGCTCACACATCGTC
TACTCAGTGCGCACAAAAACCACGTCCAGAGCTTACAAGCAGCCCGAGTTCGAAGTTAAACGGCGATATCGCGAC
TTTCTCTGGCTCTACAATACCCTTCACGGCAATAACCCTGGCTGCGTCGTCCCACCCCCTCCCGAGAAACAGGCC
GTCGGTCGTTTCAACAGCAATTTCGTCGAGAGCCGCCGGGCCGCACTCGAGAAGATGCTCAGCAAGACGGCGGCG
CATCCAACGCTGCAGCACGACGCTGATCTCAAGCTCTTCCTCGAGAGCGAGGCTTTCAATGTTGACGTCAAGCAC
AAGGAGCGGAGGGATCCTCTTCCGCCCGAGAACAAGGGTGTCTTTGGCTCGCTGGGCATCAACGTTGGAGGCGGT
ACCAAATTCGTGGAGCAGGACGACTGGTTCCACGACCGTAAAGTCTACATGGACGCCCTCGAAAATCAATTACGC
GGTCTGCTCAAAGCCATGGACATCATGGTTAGCCAGCGCAAGCTGATGGCCGAGGCCGCCGCCGAGTTTTCCGCT
TCCTTGCACGCCCTCTCCACGGTCGAGCTGTCACCGTCCCTGTCCGGGCCGCTCGACGCGCTCTCCGATCTGCAG
CTCACAATTCGAGATGTGTACGACCGTCAAGCTCAGCAAGATGTGCTGACGTTCGGCATCATCATTGACGAGTAC
ATCCGGCTCATCGGTTCCGTCAAGCAAGCGTTTAATCAGCGCCAGAAGGGCTTCTTCGCCTGGCACGCGGCTGAA
TCAGAGCTACGCAAGAAGAAGGCGACGCAGGACAAGCTCCTTCGGCAGGGAAAGAGTCAGCAGGACCGACTGAAC
CAGTACAGTGCCCAGGTCGGCGAGGCAGAGAAAAAGGTGCATCAGGCTAGGCTTCTGTTCGAAGAGATGGGTCGG
CAAATTCGGTCGGAGCTGGAGCGATTCGAAAAGGAAAAAGTGGAAGACTTCAAGAGCGGTGTCGAGACCTTTCTC
GAGAGTGCGGTCGAGGCACAAAAAGAGCTGATTGAGAAATGGGAGACGTTTCTCATGCAAATGGATGCCGAGGAC
GACGACTCTTCCGCCTTTTACTGGCCGCCGGCAACACAACAAAAGCCACCGGGCGATACGGCGATTGATCGTGCG
CGAGCAAACATGCACGATGATTCAGACTAG
Transcript >Ophcf2|02210
ATGGACGTCGAAGAGTCGCCTTGGGCTGACTCGGGTCACGGTTCGCAGCCGGAAACCTCGCAGAATGAGGCCGTC
AGCAGTCAAACGTCGTCACAGACGGCTCCAACGCCAGCGCCTCGCCTTTCGCGCGGGCCTCGTCGCCTAGTCGCT
CAACCAACTCGTCTCGAGGCCGTCGAGGACCCTCTCGGCCCTCTGAGCGGTGGTGGTGACGATGATGCTCCTGCT
CCTGCTCGTGACACGGCGCCTCCTGTGCCGCCCCAAAAAGAGCAAATGGTCATGCGCACCACCATGGCTCACCAC
CACCAGCCCGTTCGCCGTTCCACGGACCCCCACGACGTCGACGACGCTGAATTCGACTCTCCCAAGGGCCCTAGG
GCTCCGCCTCCCGTCGATGCTGCGATGCCGAGCTCAGTCAGAAGCAGTTCTCAGCCTAGCGTCAGCATCGAGCAG
GCGGCCAAGCCCACGTTTCAAATCACTGTTGGCGATCCCGTCAAGATTGGCGACTTGACCAGCTCACACATCGTC
TACTCAGTGCGCACAAAAACCACGTCCAGAGCTTACAAGCAGCCCGAGTTCGAAGTTAAACGGCGATATCGCGAC
TTTCTCTGGCTCTACAATACCCTTCACGGCAATAACCCTGGCTGCGTCGTCCCACCCCCTCCCGAGAAACAGGCC
GTCGGTCGTTTCAACAGCAATTTCGTCGAGAGCCGCCGGGCCGCACTCGAGAAGATGCTCAGCAAGACGGCGGCG
CATCCAACGCTGCAGCACGACGCTGATCTCAAGCTCTTCCTCGAGAGCGAGGCTTTCAATGTTGACGTCAAGCAC
AAGGAGCGGAGGGATCCTCTTCCGCCCGAGAACAAGGGTGTCTTTGGCTCGCTGGGCATCAACGTTGGAGGCGGT
ACCAAATTCGTGGAGCAGGACGACTGGTTCCACGACCGTAAAGTCTACATGGACGCCCTCGAAAATCAATTACGC
GGTCTGCTCAAAGCCATGGACATCATGGTTAGCCAGCGCAAGCTGATGGCCGAGGCCGCCGCCGAGTTTTCCGCT
TCCTTGCACGCCCTCTCCACGGTCGAGCTGTCACCGTCCCTGTCCGGGCCGCTCGACGCGCTCTCCGATCTGCAG
CTCACAATTCGAGATGTGTACGACCGTCAAGCTCAGCAAGATGTGCTGACGTTCGGCATCATCATTGACGAGTAC
ATCCGGCTCATCGGTTCCGTCAAGCAAGCGTTTAATCAGCGCCAGAAGGGCTTCTTCGCCTGGCACGCGGCTGAA
TCAGAGCTACGCAAGAAGAAGGCGACGCAGGACAAGCTCCTTCGGCAGGGAAAGAGTCAGCAGGACCGACTGAAC
CAGTACAGTGCCCAGGTCGGCGAGGCAGAGAAAAAGGTGCATCAGGCTAGGCTTCTGTTCGAAGAGATGGGTCGG
CAAATTCGGTCGGAGCTGGAGCGATTCGAAAAGGAAAAAGTGGAAGACTTCAAGAGCGGTGTCGAGACCTTTCTC
GAGAGTGCGGTCGAGGCACAAAAAGAGCTGATTGAGAAATGGGAGACGTTTCTCATGCAAATGGATGCCGAGGAC
GACGACTCTTCCGCCTTTTACTGGCCGCCGGCAACACAACAAAAGCCACCGGGCGATACGGCGATTGATCGTGCG
CGAGCAAACATGCACGATGATTCAGACTAG
Gene >Ophcf2|02210
ATGGACGTCGAAGAGTCGCCTTGGGCTGACTCGGGTCACGGTTCGCAGCCGGAAACCTCGCAGAATGAGGCCGTC
AGCAGTCAAACGTCGTCACAGACGGCTCCAACGCCAGCGCCTCGCCTTTCGCGCGGGCCTCGTCGCCTAGTCGCT
CAACCAACTCGTCTCGAGGCCGTCGAGGACCCTCTCGGCCCTCTGAGCGGTGGTGGTGACGATGATGCTCCTGCT
CCTGCTCGTGACACGGCGCCTCCTGTGCCGCCCCAAAAAGAGCAAATGGTCATGCGCACCACCATGGCTCACCAC
CACCAGCCCGTTCGCCGTTCCACGGACCCCCACGACGTCGACGACGCTGAATTCGACTCTCCCAAGGGCCCTAGG
GCTCCGCCTCCCGTCGATGCTGCGATGCCGAGCTCAGTCAGAAGCAGTTCTCAGCCTAGCGTCAGCATCGAGCAG
GCGGCCAAGCCCACGTTTCAAATCACTGTTGGCGATCCCGTCAAGATTGGCGACTTGACCAGCTCACACATCGTC
TACTCAGTGCGCACAAAAGTATGTCAACCTTGACTCGCTTAGAAGCATTTTGTTAACGACCACAGACCACGTCCA
GAGCTTACAAGCAGCCCGAGTTCGAAGTTAAACGGCGATATCGCGACTTTCTCTGGCTCTACAATACCCTTCACG
GCAATAACCCTGGCTGCGTCGTCCCACCCCCTCCCGAGAAACAGGCCGTCGGTCGTTTCAACAGCAATTTCGTCG
AGAGCCGCCGGGCCGCACTCGAGAAGATGCTCAGCAAGACGGCGGCGCATCCAACGCTGCAGCACGACGCTGATC
TCAAGCTCTTCCTCGAGAGCGAGGCTTTCAATGTTGACGTCAAGCACAAGGAGCGGAGGGATCCTCTTCCGCCCG
AGAACAAGGGTGTCTTTGGCTCGCTGGGCATCAACGTTGGAGGCGGTACCAAATTCGTGGAGCAGGACGACTGGT
TCCACGACCGTAAAGTCTACATGGACGCCCTCGAAAATCAATTACGCGGTCTGCTCAAAGCCATGGACATCATGG
TTAGCCAGCGCAAGCTGATGGCCGAGGCCGCCGCCGAGTTTTCCGCTTCCTTGCACGCCCTCTCCACGGTCGAGC
TGTCACCGTCCCTGTCCGGGCCGCTCGACGCGCTCTCCGATCTGCAGCTCACAATTCGAGATGTGTACGACCGTC
AAGCTCAGCAAGATGTGCTGACGTTCGGCATCATCATTGACGAGTACATCCGGCTCATCGGTTCCGTCAAGCAAG
CGTTTAATCAGCGCCAGAAGGGCTTCTTCGCCTGGCACGCGGCTGAATCAGAGCTACGCAAGAAGAAGGCGACGC
AGGACAAGCTCCTTCGGCAGGGAAAGAGTCAGCAGGACCGACTGAACCAGTACAGTGCCCAGGTCGGCGAGGCAG
AGAAAAAGGTGCATCAGGCTAGGCTTCTGTTCGAAGAGATGGGTCGGCAAATTCGGTCGGAGCTGGAGCGATTCG
AAAAGGAAAAAGTGGAAGACTTCAAGAGCGGTGTCGAGACCTTTCTCGAGAGTGCGGTCGAGGCACAAAAAGAGG
TACCGCCCTTGATGACTCTTGTGAATTGGCCGCAGACGGCAGACAGGCTGACTGGATAACACCTAGCTGATTGAG
AAATGGGAGACGTTTCTCATGCAAATGGATGCCGAGGACGACGACTCTTCCGCCTTTTACTGGCCGCCGGCAACA
CAACAAAAGCCACCGGGCGATACGGCGATTGATCGTGCGCGAGCAAACATGCACGATGATTCAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail