Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02209
Gene name
Locationscaffold_02:2918443..2920945
Strand+
Gene length (bp)2502
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain 6.7E-44 81 211
PF00400 WD40 WD domain, G-beta repeat 5.9E-03 365 399
PF00400 WD40 WD domain, G-beta repeat 1.7E-02 419 476
PF00400 WD40 WD domain, G-beta repeat 3.8E-03 481 517
PF00400 WD40 WD domain, G-beta repeat 3.8E-07 524 562
PF00400 WD40 WD domain, G-beta repeat 2.0E-04 566 604
PF00400 WD40 WD domain, G-beta repeat 3.0E-07 615 647

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal|Nuclear export signal 0.5973 0.5159 0.0241 0.0769 0.2718 0.0413 0.0929 0.1394 0.2245 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2581
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4762
Ophiocordyceps australis map64 (Brazil) OphauB2|959
Ophiocordyceps camponoti-floridani Ophcf2|02209 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2400
Ophiocordyceps kimflemingae Ophio5|3167
Ophiocordyceps subramaniannii Hirsu2|3870

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02209
MDRLEKQPVPPYPVQIRPVPSGPVQIHPVPSVPAQFRNALAAPVTDYLLKRGFNRTEEVFRQESKHLGVDGKPLQ
QLANLGPKKYQKSFKLVKDWIDNNLDLYKFELSKLLWPIFVYSFLDLVGNGYADDSKTFLKELGPNFQPAHSDDL
KNLSTVTLPQHIEANSMTRLYRNNKYRIPLNQHATGDLFNFLERETEQGGSVIRQLLVTYCQVDSTARGPITQFS
FEAVFRRSQNADIDDVDSREGIPGVNIGLSNRDVLDPSAPLKLGPLPMEQELREDVRAELEDIERQNPPPEGVTS
LVDDFDQKIKREDSADAPSRADLPLPPSRPRDIMLEMQKVRENRDRFKIEGRTGGVGVAVSACMFTFHNTLGCVS
SMDFSNDGRLVAAGTTESYIRVWSLDGKELPSANAHEKDAKFNSRKLIGHSGPVYDVSFSDSVSGPPQKLFGDEG
RNNAPIDGRPKLLLSCAADGHVRLWSLEAWACLCLYKSHDGPVFRCLWGPHGHYFMSAGYDKVARIWMQDHASPQ
RLLVGHDTSISAIAWHPNGAYVFSASDETDKSIRMWSVVTGQCVRVFSGHTDFISALECAPNGAILASADCAGNI
YFWDISKGTRIKRSRGHGRGGIWSLSFSAESTVLVSGGQDGTVRVWDVESPADPQKVAQQVGLDSVISGVDSVSA
AADASRGNTVAAGQAAGTAGSGIHKKKNKEVMVTPDQISAFPTKKTPVTKVKFTRMNLIIAGGCYDPER*
Coding >Ophcf2|02209
ATGGATCGACTTGAGAAGCAGCCTGTGCCCCCTTACCCTGTTCAAATACGTCCAGTACCCTCGGGCCCTGTTCAA
ATTCATCCTGTACCATCTGTCCCTGCCCAATTCCGCAATGCGCTCGCGGCTCCTGTGACGGATTACCTGCTGAAG
AGAGGTTTCAACCGCACAGAAGAGGTGTTTCGTCAGGAATCCAAGCACCTGGGAGTCGATGGAAAGCCTCTCCAG
CAGCTCGCAAACCTGGGACCGAAGAAGTACCAAAAATCATTTAAGCTGGTGAAAGACTGGATCGACAACAACTTA
GATCTCTACAAGTTCGAGTTGTCGAAACTTCTCTGGCCAATTTTTGTCTACTCGTTCCTCGATTTGGTCGGAAAT
GGATACGCAGATGATTCCAAGACCTTCCTGAAGGAGCTGGGGCCCAACTTTCAACCTGCTCACAGCGATGACCTC
AAAAATTTATCTACGGTCACCCTGCCGCAACACATTGAAGCCAACTCCATGACGAGGCTGTACAGGAATAACAAG
TATCGCATCCCTCTAAATCAGCACGCCACAGGTGATCTTTTCAATTTCCTGGAGCGTGAAACGGAGCAAGGGGGT
TCTGTGATTCGACAGCTCCTCGTCACCTACTGTCAGGTCGACTCCACAGCTCGCGGCCCCATCACACAATTCAGT
TTCGAGGCCGTCTTTCGGCGATCGCAAAACGCAGATATTGACGATGTCGACAGCCGGGAGGGCATACCGGGCGTT
AACATCGGACTGTCCAACAGGGATGTTCTCGACCCTTCAGCGCCGCTCAAACTCGGCCCTCTGCCCATGGAGCAA
GAGCTTCGTGAAGATGTCAGAGCCGAGCTCGAGGATATTGAGCGTCAAAATCCACCTCCCGAGGGTGTGACAAGT
CTCGTCGACGACTTTGATCAGAAGATCAAGCGTGAAGATAGTGCCGACGCGCCGAGCCGCGCCGATCTCCCGTTG
CCCCCGTCCCGGCCGCGCGACATCATGTTGGAGATGCAAAAAGTGCGTGAGAACCGTGATCGCTTCAAAATCGAG
GGTAGGACCGGGGGTGTGGGTGTTGCGGTCAGCGCCTGCATGTTCACCTTTCACAATACGCTTGGATGTGTATCG
TCGATGGACTTTTCAAATGACGGCCGTCTGGTCGCTGCGGGCACAACGGAGTCGTACATTCGAGTCTGGTCTCTG
GATGGCAAGGAACTGCCGTCAGCCAACGCTCACGAGAAAGATGCCAAATTTAACAGCCGCAAACTGATCGGTCAC
TCGGGCCCGGTTTACGACGTCTCCTTTTCCGACTCGGTATCGGGGCCGCCGCAAAAGTTGTTTGGTGACGAGGGC
AGAAATAACGCTCCCATCGACGGCAGGCCGAAGCTCCTGCTGTCCTGTGCCGCAGACGGCCACGTTCGTCTCTGG
TCTCTCGAGGCATGGGCCTGTTTGTGTCTCTACAAGTCGCACGACGGACCTGTATTCCGTTGCTTATGGGGTCCC
CACGGTCACTACTTTATGAGCGCCGGTTACGACAAAGTGGCACGCATCTGGATGCAGGACCATGCCTCGCCCCAG
CGCCTGTTGGTAGGGCACGACACGTCTATATCGGCCATTGCCTGGCATCCCAACGGTGCTTACGTCTTCTCGGCC
TCGGATGAGACAGATAAGTCGATACGCATGTGGTCTGTGGTGACGGGTCAATGTGTTCGAGTCTTCTCGGGACAC
ACCGACTTTATCAGCGCTCTCGAGTGTGCGCCCAACGGTGCAATCCTGGCCAGCGCCGACTGCGCCGGTAACATT
TATTTTTGGGACATCAGCAAAGGGACTCGCATCAAACGGTCCCGTGGCCACGGACGAGGTGGAATTTGGTCCCTT
AGCTTCAGCGCCGAATCCACCGTGCTCGTCTCCGGCGGTCAAGACGGGACCGTCCGGGTGTGGGACGTGGAATCG
CCAGCCGATCCGCAAAAGGTGGCACAGCAGGTCGGACTGGACTCGGTCATCTCCGGCGTCGACAGTGTCAGTGCC
GCAGCTGATGCCTCACGGGGAAACACGGTTGCAGCTGGTCAAGCCGCTGGGACAGCCGGCAGCGGAATCCATAAG
AAAAAGAACAAGGAGGTGATGGTGACGCCGGACCAGATCAGCGCGTTCCCGACCAAGAAGACACCTGTGACAAAG
GTCAAGTTCACCCGGATGAACCTCATCATTGCCGGAGGCTGCTACGATCCCGAGCGCTAG
Transcript >Ophcf2|02209
ATGGATCGACTTGAGAAGCAGCCTGTGCCCCCTTACCCTGTTCAAATACGTCCAGTACCCTCGGGCCCTGTTCAA
ATTCATCCTGTACCATCTGTCCCTGCCCAATTCCGCAATGCGCTCGCGGCTCCTGTGACGGATTACCTGCTGAAG
AGAGGTTTCAACCGCACAGAAGAGGTGTTTCGTCAGGAATCCAAGCACCTGGGAGTCGATGGAAAGCCTCTCCAG
CAGCTCGCAAACCTGGGACCGAAGAAGTACCAAAAATCATTTAAGCTGGTGAAAGACTGGATCGACAACAACTTA
GATCTCTACAAGTTCGAGTTGTCGAAACTTCTCTGGCCAATTTTTGTCTACTCGTTCCTCGATTTGGTCGGAAAT
GGATACGCAGATGATTCCAAGACCTTCCTGAAGGAGCTGGGGCCCAACTTTCAACCTGCTCACAGCGATGACCTC
AAAAATTTATCTACGGTCACCCTGCCGCAACACATTGAAGCCAACTCCATGACGAGGCTGTACAGGAATAACAAG
TATCGCATCCCTCTAAATCAGCACGCCACAGGTGATCTTTTCAATTTCCTGGAGCGTGAAACGGAGCAAGGGGGT
TCTGTGATTCGACAGCTCCTCGTCACCTACTGTCAGGTCGACTCCACAGCTCGCGGCCCCATCACACAATTCAGT
TTCGAGGCCGTCTTTCGGCGATCGCAAAACGCAGATATTGACGATGTCGACAGCCGGGAGGGCATACCGGGCGTT
AACATCGGACTGTCCAACAGGGATGTTCTCGACCCTTCAGCGCCGCTCAAACTCGGCCCTCTGCCCATGGAGCAA
GAGCTTCGTGAAGATGTCAGAGCCGAGCTCGAGGATATTGAGCGTCAAAATCCACCTCCCGAGGGTGTGACAAGT
CTCGTCGACGACTTTGATCAGAAGATCAAGCGTGAAGATAGTGCCGACGCGCCGAGCCGCGCCGATCTCCCGTTG
CCCCCGTCCCGGCCGCGCGACATCATGTTGGAGATGCAAAAAGTGCGTGAGAACCGTGATCGCTTCAAAATCGAG
GGTAGGACCGGGGGTGTGGGTGTTGCGGTCAGCGCCTGCATGTTCACCTTTCACAATACGCTTGGATGTGTATCG
TCGATGGACTTTTCAAATGACGGCCGTCTGGTCGCTGCGGGCACAACGGAGTCGTACATTCGAGTCTGGTCTCTG
GATGGCAAGGAACTGCCGTCAGCCAACGCTCACGAGAAAGATGCCAAATTTAACAGCCGCAAACTGATCGGTCAC
TCGGGCCCGGTTTACGACGTCTCCTTTTCCGACTCGGTATCGGGGCCGCCGCAAAAGTTGTTTGGTGACGAGGGC
AGAAATAACGCTCCCATCGACGGCAGGCCGAAGCTCCTGCTGTCCTGTGCCGCAGACGGCCACGTTCGTCTCTGG
TCTCTCGAGGCATGGGCCTGTTTGTGTCTCTACAAGTCGCACGACGGACCTGTATTCCGTTGCTTATGGGGTCCC
CACGGTCACTACTTTATGAGCGCCGGTTACGACAAAGTGGCACGCATCTGGATGCAGGACCATGCCTCGCCCCAG
CGCCTGTTGGTAGGGCACGACACGTCTATATCGGCCATTGCCTGGCATCCCAACGGTGCTTACGTCTTCTCGGCC
TCGGATGAGACAGATAAGTCGATACGCATGTGGTCTGTGGTGACGGGTCAATGTGTTCGAGTCTTCTCGGGACAC
ACCGACTTTATCAGCGCTCTCGAGTGTGCGCCCAACGGTGCAATCCTGGCCAGCGCCGACTGCGCCGGTAACATT
TATTTTTGGGACATCAGCAAAGGGACTCGCATCAAACGGTCCCGTGGCCACGGACGAGGTGGAATTTGGTCCCTT
AGCTTCAGCGCCGAATCCACCGTGCTCGTCTCCGGCGGTCAAGACGGGACCGTCCGGGTGTGGGACGTGGAATCG
CCAGCCGATCCGCAAAAGGTGGCACAGCAGGTCGGACTGGACTCGGTCATCTCCGGCGTCGACAGTGTCAGTGCC
GCAGCTGATGCCTCACGGGGAAACACGGTTGCAGCTGGTCAAGCCGCTGGGACAGCCGGCAGCGGAATCCATAAG
AAAAAGAACAAGGAGGTGATGGTGACGCCGGACCAGATCAGCGCGTTCCCGACCAAGAAGACACCTGTGACAAAG
GTCAAGTTCACCCGGATGAACCTCATCATTGCCGGAGGCTGCTACGATCCCGAGCGCTAG
Gene >Ophcf2|02209
ATGGATCGACTTGAGAAGCAGCCTGTGCCCCCTTACCCTGTTCAAATACGTCCAGTACCCTCGGGCCCTGTTCAA
ATTCATCCTGTACCATCTGTCCCTGCCCAATTCCGCAATGCGCTCGCGGCTCCTGTACCCGAGAGCTCTCCCGCA
TCTGGCACTCGCAGCAACACCAGACCGGACGTTAGAGCTGATGTATTCCAATTTGTTTTCAAAAACCCTTCATGC
ATCTCATCGCGTTCTTTTCATCGGCCTTTTTCTGCCTCAGGCGCCTGACCGAGACTTAGGTGACGGATTACCTGC
TGAAGAGAGGTTTCAACCGCACAGAAGAGGTGTTTCGTCAGGAATCCAAGCACCTGGGAGTCGATGGAAAGCCTC
TCCAGCAGCTCGCAAACCTGGGACCGAAGAAGTACCAAAAATCATTTAAGCTGGTGAAAGACTGGATCGACAACA
ACTTAGATCTCTACAAGGTACGCGTCGTTTCGTCTCTCTCCCGCCGACAAATGCTTATGGTTCATGCAGTTCGAG
TTGTCGAAACTTCTCTGGCCAATTTTTGTCTACTCGTTCCTCGATTTGGTCGGAAATGGATACGCAGATGATTCC
AAGACCTTCCTGAAGGAGCTGGGGCCCAACTTTCAACCTGCTCACAGCGATGACCTCAAAAATTTATCTACGGTC
ACCCTGCCGCAACACATTGAAGCCAACTCCATGACGAGGCTGTACAGGAATAACAAGTATCGCATCCCTCTAAAT
CAGCACGCCACAGGTGATCTTTTCAATTTCCTGGAGCGTGAAACGGAGCAAGGGGGTTCTGTGATTCGACAGCTC
CTCGTCACCTACTGTCAGGTCGACTCCACAGCTCGCGGCCCCATCACACAATTCAGTTTCGAGGCCGTCTTTCGG
CGATCGCAAAACGCAGATATTGACGATGTCGACAGCCGGGAGGGCATACCGGGCGTTAACATCGGACTGTCCAAC
AGGGATGTTCTCGACCCTTCAGCGCCGCTCAAACTCGGCCCTCTGCCCATGGAGCAAGAGCTTCGTGAAGATGTC
AGAGCCGAGCTCGAGGATATTGAGCGTCAAAATCCACCTCCCGAGGGTGTGACAAGTCTCGTCGACGACTTTGAT
CAGAAGATCAAGCGTGAAGATAGTGCCGACGCGCCGAGCCGCGCCGATCTCCCGTTGCCCCCGTCCCGGCCGCGC
GACATCATGTTGGAGATGCAAAAAGTGCGTGAGAACCGTGATCGCTTCAAAATCGAGGGTAGGACCGGGGGTGTG
GGTGTTGCGGTCAGCGCCTGCATGTTCACCTTTCACAATACGCTTGGATGGTGAGTTCAGCATGCAGCCAGCACA
AACCCTTATGAGCAGATGCTGACATACCGCGACAGTGTATCGTCGATGGACTTTTCAAATGACGGCCGTCTGGTC
GCTGCGGGCACAACGGAGTCGTACATTCGAGTCTGGTCTCTGGATGGCAAGGAACTGCCGTCAGCCAACGCTCAC
GAGAAAGATGCCAAATTTAACAGCCGCAAACTGATCGGTCACTCGGGCCCGGTTTACGACGTCTCCTTTTCCGAC
TCGGTATCGGGGCCGCCGCAAAAGTTGTTTGGTGACGAGGGCAGAAATAACGCTCCCATCGACGGCAGGCCGAAG
CTCCTGCTGTCCTGTGCCGCAGACGGCCACGTTCGTCTCTGGTCTCTCGAGGCATGGGCCTGTTTGTGTCTCTAC
AAGTCGCACGACGGACCTGTATTCCGTTGCTTATGGGGTCCCCACGGTCACTACTTTATGAGCGCCGGTTACGAC
AAAGTGGCACGCATCTGGATGCAGGACCATGCCTCGCCCCAGCGCCTGTTGGTAGGGCACGACACGTCTATATCG
GCCATTGCCTGGCATCCCAACGGTGCTTACGTCTTCTCGGCCTCGGATGAGACAGATAAGTCGATACGCATGTGG
TCTGTGGTGACGGGTCAATGTGTTCGAGTCTTCTCGGGACACACCGACTTTATCAGCGCTCTCGAGTGTGCGCCC
AACGGTGCAATCCTGGCCAGCGCCGACTGCGCCGGTAACATTTATTTTTGGGACATCAGCAAAGGGACTCGCATC
AAACGGTCCCGTGGCCACGGACGAGGTGGAATTTGGTCCCTTAGCTTCAGCGCCGAATCCACCGTGCTCGTCTCC
GGCGGTCAAGACGGGACCGTCCGGGTGTGGGACGTGGAATCGCCAGCCGATCCGCAAAAGGTGGCACAGCAGGTC
GGACTGGACTCGGTCATCTCCGGCGTCGACAGTGTCAGTGCCGCAGCTGATGCCTCACGGGGAAACACGGTTGCA
GCTGGTCAAGCCGCTGGGACAGCCGGCAGCGGAATCCATAAGAAAAAGAACAAGGAGGTGATGGTGACGCCGGAC
CAGATCAGCGCGTTCCCGACCAAGAAGACACCTGTGACAAAGGTCAAGTTCACCCGGATGAACCTCATCATTGCC
GGAGGCTGCTACGATCCCGAGCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail