Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02207
Gene name
Locationscaffold_02:2912341..2913872
Strand-
Gene length (bp)1531
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 1.9E-65 131 374
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.5E-30 5 103

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 46 68 22
3 78 100 22
4 121 143 22
5 158 180 22
6 251 273 22
7 278 300 22
8 313 335 22
9 350 372 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02207
MNIAEGESVSKEPIDTVLWVHIFVQSFAYGIVFPIGMVLGMTKSRWHVPTQIFGSVFAVLGFFLGHAHGGREFIG
NNAHSGFATILQLLLVCQVVLGLYLKGHWERGINGRIRRFIRPCHSFIGKLMPVLSWTQMLFGGITALGFCQADH
FGQCLAHFIMGSAFIAYGITLSLILVVGQLWIRRTGRSQEFYDSAVIAAWGCVNTFTEHRWGSAWVRNDWQHTTM
GIIWWSAGLVGMWLSRDRDGNPKRNFVPGFVVFMTGWAMSAHPQSLMVSAMTHSMFGKTLMAVGLTRVIEIAFVL
KDKQSLTDDGRSWNSFQFVPVFLMYAAGFLFMGATEEQMQLVDQSAVDHVSYILMLYSVAFIVFLFSNMLIHLYD
RLANPVDNRELGLYDRLAEPAVESRALGTGNGNGHVSTERRLRDCDEFELDGLMSDDDGPSSRGLDSPSSTLGKN
EATSVR*
Coding >Ophcf2|02207
ATGAACATCGCAGAGGGCGAGTCGGTCTCTAAGGAGCCCATTGATACGGTGCTATGGGTTCACATATTCGTCCAG
TCGTTCGCCTACGGCATCGTCTTCCCTATTGGGATGGTATTGGGTATGACGAAATCGAGATGGCACGTCCCGACC
CAAATCTTCGGCTCCGTCTTCGCGGTCCTCGGCTTCTTTCTCGGTCACGCCCATGGTGGCCGTGAGTTCATCGGC
AACAACGCCCACTCGGGCTTCGCCACGATTCTACAGCTGCTCCTCGTCTGCCAAGTTGTTCTTGGGCTCTATCTC
AAAGGCCACTGGGAGAGGGGGATCAACGGCAGAATCAGGAGATTCATCCGGCCATGCCATTCCTTCATCGGCAAG
CTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTCGGCGGCATCACGGCGCTCGGCTTCTGTCAAGCCGACCAT
TTCGGCCAATGCCTAGCTCATTTCATCATGGGTAGCGCCTTTATTGCCTACGGCATCACCTTGTCCCTGATTCTC
GTCGTTGGCCAGCTGTGGATCCGTCGCACCGGGCGATCGCAAGAGTTCTACGACAGTGCCGTCATTGCCGCCTGG
GGCTGTGTCAATACCTTTACCGAACACCGCTGGGGCAGCGCTTGGGTCAGGAACGACTGGCAGCACACCACCATG
GGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAAC
TTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTCATGGTCAGTGCT
ATGACGCATAGCATGTTTGGGAAGACGCTCATGGCCGTCGGCCTGACGCGTGTCATCGAGATTGCATTCGTCCTC
AAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAACAGCTTCCAATTCGTTCCCGTGTTTCTCATGTAC
GCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCAGCTCGTCGACCAGTCGGCTGTCGATCACGTG
TCGTACATTCTCATGTTATACTCGGTCGCCTTCATCGTCTTCTTGTTTTCCAACATGCTGATCCACTTGTACGAC
CGGCTCGCGAACCCCGTGGATAACCGAGAGCTAGGTCTGTACGACCGGCTTGCGGAACCTGCCGTAGAGAGCAGG
GCTTTGGGTACCGGCAACGGCAACGGCCACGTCTCGACAGAAAGGCGATTGCGGGACTGCGACGAGTTTGAACTG
GACGGGCTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCTGGGCAAAAAC
GAGGCCACCTCGGTGCGATGA
Transcript >Ophcf2|02207
ATGAACATCGCAGAGGGCGAGTCGGTCTCTAAGGAGCCCATTGATACGGTGCTATGGGTTCACATATTCGTCCAG
TCGTTCGCCTACGGCATCGTCTTCCCTATTGGGATGGTATTGGGTATGACGAAATCGAGATGGCACGTCCCGACC
CAAATCTTCGGCTCCGTCTTCGCGGTCCTCGGCTTCTTTCTCGGTCACGCCCATGGTGGCCGTGAGTTCATCGGC
AACAACGCCCACTCGGGCTTCGCCACGATTCTACAGCTGCTCCTCGTCTGCCAAGTTGTTCTTGGGCTCTATCTC
AAAGGCCACTGGGAGAGGGGGATCAACGGCAGAATCAGGAGATTCATCCGGCCATGCCATTCCTTCATCGGCAAG
CTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTCGGCGGCATCACGGCGCTCGGCTTCTGTCAAGCCGACCAT
TTCGGCCAATGCCTAGCTCATTTCATCATGGGTAGCGCCTTTATTGCCTACGGCATCACCTTGTCCCTGATTCTC
GTCGTTGGCCAGCTGTGGATCCGTCGCACCGGGCGATCGCAAGAGTTCTACGACAGTGCCGTCATTGCCGCCTGG
GGCTGTGTCAATACCTTTACCGAACACCGCTGGGGCAGCGCTTGGGTCAGGAACGACTGGCAGCACACCACCATG
GGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTCAGCAGGGACCGGGATGGCAATCCCAAGCGCAAC
TTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATGTCGGCTCATCCGCAGTCGCTCATGGTCAGTGCT
ATGACGCATAGCATGTTTGGGAAGACGCTCATGGCCGTCGGCCTGACGCGTGTCATCGAGATTGCATTCGTCCTC
AAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAACAGCTTCCAATTCGTTCCCGTGTTTCTCATGTAC
GCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCAGCTCGTCGACCAGTCGGCTGTCGATCACGTG
TCGTACATTCTCATGTTATACTCGGTCGCCTTCATCGTCTTCTTGTTTTCCAACATGCTGATCCACTTGTACGAC
CGGCTCGCGAACCCCGTGGATAACCGAGAGCTAGGTCTGTACGACCGGCTTGCGGAACCTGCCGTAGAGAGCAGG
GCTTTGGGTACCGGCAACGGCAACGGCCACGTCTCGACAGAAAGGCGATTGCGGGACTGCGACGAGTTTGAACTG
GACGGGCTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCTGGGCAAAAAC
GAGGCCACCTCGGTGCGATGA
Gene >Ophcf2|02207
ATGAACATCGCAGAGGGCGAGTCGGTCTCTAAGGAGCCCATTGTGAGTGGCGACAAGCTTGCTTTCATTTTAGTC
CTTCTAACCCGGAGTCCAGGATACGGTGCTATGGGTTCACATATTCGTCCAGTCGTTCGCCTACGGCATCGTCTT
CCCTATTGGGATGGTATTGGGTGTATGTTGGCCCGTTCCCCTCTTTCCCCAGCGACGCTGATCCTTGGCGACAGA
TGACGAAATCGAGATGGCACGTCCCGACCCAAATCTTCGGCTCCGTCTTCGCGGTCCTCGGCTTCTTTCTCGGTC
ACGCCCATGGTGGCCGTGAGTTCATCGGCAACAACGCCCACTCGGGCTTCGCCACGATTCTACAGCTGCTCCTCG
TCTGCCAAGTTGTTCTTGGGCTCTATCTCAAAGGCCACTGGGAGAGGGGGATCAACGGCAGAATCAGGAGATTCA
TCCGGCCATGCCATTCCTTCATCGGCAAGCTGATGCCGGTTCTCTCGTGGACCCAGATGCTCTTCGGCGGCATCA
CGGCGCTCGGCTTCTGTCAAGCCGACCATTTCGGCCAATGCCTAGCTCATTTCATCATGGGTAGCGCCTTTATTG
CCTACGGCATCACCTTGTCCCTGATTCTCGTCGTTGGCCAGCTGTGGATCCGTCGCACCGGGCGATCGCAAGAGT
TCTACGACAGTGCCGTCATTGCCGCCTGGGGCTGTGTCAATACCTTTACCGAACACCGCTGGGGCAGCGCTTGGG
TCAGGAACGACTGGCAGCACACCACCATGGGCATCATCTGGTGGAGCGCCGGCCTCGTCGGCATGTGGCTCAGCA
GGGACCGGGATGGCAATCCCAAGCGCAACTTTGTGCCGGGCTTCGTCGTCTTCATGACGGGCTGGGCCATGTCGG
CTCATCCGCAGTCGCTCATGGTCAGTGCTATGACGCATAGCATGTTTGGGAAGACGCTCATGGCCGTCGGCCTGA
CGCGTGTCATCGAGATTGCATTCGTCCTCAAGGACAAGCAGTCGCTGACGGATGACGGCCGCTCCTGGAACAGCT
TCCAATTCGTTCCCGTGTTTGTGAGTTCATCTCTCCAATCCTTGCCCTTGGAGCTGTCGAAACTGACCATGTGCA
GCTCATGTACGCCGCGGGCTTTCTCTTTATGGGAGCGACGGAAGAGCAGATGCAGCTCGTCGACCAGTCGGCTGT
CGATCACGTGTCGTACATTCTCATGTTATACTCGGTCGCCTTCATCGTCTTCTTGTTTTCCAACATGCTGATCCA
CTTGTACGACCGGCTCGCGAACCCCGTGGATAACCGAGAGCTAGGTCTGTACGACCGGCTTGCGGAACCTGCCGT
AGAGAGCAGGGCTTTGGGTACCGGCAACGGCAACGGCCACGTCTCGACAGAAAGGCGATTGCGGGACTGCGACGA
GTTTGAACTGGACGGGCTAATGAGTGATGACGACGGACCATCGTCGCGCGGTCTCGACTCTCCGTCATCAACGCT
GGGCAAAAACGAGGCCACCTCGGTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail