Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02199
Gene name
Locationscaffold_02:2886875..2887719
Strand+
Gene length (bp)844
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04106 APG5 Autophagy protein Apg5 1.6E-43 94 256

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0005737 cytoplasm Yes
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No
GO:0009987 cellular process No
GO:0061919 process utilizing autophagic mechanism No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6292 0.742 0.1035 0.0249 0.2242 0.0121 0.0788 0.1616 0.1087 0.0241

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4794
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3307
Ophiocordyceps australis map64 (Brazil) OphauB2|5013
Ophiocordyceps camponoti-floridani Ophcf2|02199 (this protein)
Ophiocordyceps kimflemingae Ophio5|2882
Ophiocordyceps subramaniannii Hirsu2|10273

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02199
MTSPGSIPQTLWDSRIPLLIQHATRPSTTPFVTSVPRFSYLALLLPRLTAFFGAPCSSFHFEEVQLRNLAAGLLM
DLYKPSWPWRLTVGDGVGWDIADTFLNCVKEADFIRNGNANQIMKMSKDHTTQLWNAVIDNDYASWLQVHTRLLN
APTTLKHIPLRIYIPSPPPEKESSLEPDTGSFKVIQSLAAAAGPDRRPTLLGQALKAAMPKLFPSSRDPVLASVV
LHGAPAPFDAPLAELMKEAAYPDGWLCLVVVV*
Coding >Ophcf2|02199
ATGACGTCTCCGGGCTCGATCCCGCAGACGCTATGGGACTCGCGGATCCCGCTTCTCATTCAGCACGCGACGCGG
CCCTCGACGACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTACCTGGCGCTCCTGCTGCCGCGGCTGACGGCC
TTTTTCGGCGCGCCCTGCTCGAGCTTCCACTTTGAGGAGGTGCAGCTGAGGAATCTGGCGGCTGGGCTGCTGATG
GACTTGTATAAACCTAGTTGGCCGTGGCGGCTGACTGTGGGGGACGGGGTTGGATGGGATATCGCCGATACTTTT
CTTAACTGTGTTAAGGAGGCCGACTTTATTCGCAACGGCAACGCAAACCAGATCATGAAGATGTCCAAGGACCAT
ACGACGCAACTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGCTCCAGGTCCATACTCGCCTCCTCAAC
GCACCGACAACACTCAAGCACATTCCCTTGAGGATATACATCCCCTCGCCTCCGCCAGAAAAGGAATCTAGCCTC
GAACCAGACACCGGCTCCTTCAAGGTCATACAGTCGCTCGCCGCCGCCGCCGGCCCGGATCGAAGACCGACGCTT
CTGGGCCAGGCGCTTAAGGCTGCGATGCCCAAACTGTTCCCTAGCAGTCGAGACCCTGTTCTTGCTAGCGTTGTT
TTGCATGGTGCGCCGGCTCCGTTCGACGCACCGCTGGCGGAACTGATGAAGGAGGCTGCGTATCCCGATGGCTGG
CTGTGCTTGGTCGTCGTTGTCTAG
Transcript >Ophcf2|02199
ATGACGTCTCCGGGCTCGATCCCGCAGACGCTATGGGACTCGCGGATCCCGCTTCTCATTCAGCACGCGACGCGG
CCCTCGACGACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTACCTGGCGCTCCTGCTGCCGCGGCTGACGGCC
TTTTTCGGCGCGCCCTGCTCGAGCTTCCACTTTGAGGAGGTGCAGCTGAGGAATCTGGCGGCTGGGCTGCTGATG
GACTTGTATAAACCTAGTTGGCCGTGGCGGCTGACTGTGGGGGACGGGGTTGGATGGGATATCGCCGATACTTTT
CTTAACTGTGTTAAGGAGGCCGACTTTATTCGCAACGGCAACGCAAACCAGATCATGAAGATGTCCAAGGACCAT
ACGACGCAACTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGCTCCAGGTCCATACTCGCCTCCTCAAC
GCACCGACAACACTCAAGCACATTCCCTTGAGGATATACATCCCCTCGCCTCCGCCAGAAAAGGAATCTAGCCTC
GAACCAGACACCGGCTCCTTCAAGGTCATACAGTCGCTCGCCGCCGCCGCCGGCCCGGATCGAAGACCGACGCTT
CTGGGCCAGGCGCTTAAGGCTGCGATGCCCAAACTGTTCCCTAGCAGTCGAGACCCTGTTCTTGCTAGCGTTGTT
TTGCATGGTGCGCCGGCTCCGTTCGACGCACCGCTGGCGGAACTGATGAAGGAGGCTGCGTATCCCGATGGCTGG
CTGTGCTTGGTCGTCGTTGTCTAG
Gene >Ophcf2|02199
ATGACGTCTCCGGGCTCGATCCCGCAGACGCTATGGGACTCGCGGATCCCGCTTCTCATTCAGCACGCGACGCGG
CCCTCGACGACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTACCTGGCGCTCCTGCTGCCGCGGCTGACGGCC
TTTTTCGGCGCGCCCTGCTCGAGCTTCCACTTTGAGGAGGTGCAGCTGAGGAATCTGGCGGCTGGGCTGCTGATG
GACTTGTATAAACCTAGTTGGCCGTGGCGGCTGACTGTGGGGGACGGGGTTGGATGGGATATCGCCGATACTTTT
CTTAACTGTGTTAAGGAGGTGAGTTTATTCTTGTTTCGGAGGGGGATCATGGATGGTAAGAGGCTTAGACTCATG
ATTCGGGACTCAGGCCGACTTTATTCGCAACGGCAACGCAAACCAGATCATGAAGATGTCCAAGGACCATACGAC
GCAACTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGCTCCAGGTCCATACTCGCCTCCTCAACGCACC
GACAACACTCAAGCACATTCCCTTGAGGATATACATCCCCTCGCCTCCGCCAGAAAAGGAATCTAGCCTCGAACC
AGACACCGGCTCCTTCAAGGTCATACAGTCGCTCGCCGCCGCCGCCGGCCCGGATCGAAGACCGACGCTTCTGGG
CCAGGCGCTTAAGGCTGCGATGCCCAAACTGTTCCCTAGCAGTCGAGACCCTGTTCTTGCTAGCGTTGTTTTGCA
TGGTGCGCCGGCTCCGTTCGACGCACCGCTGGCGGAACTGATGAAGGAGGCTGCGTATCCCGATGGCTGGCTGTG
CTTGGTCGTCGTTGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail