Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02196
Gene name
Locationscaffold_02:2880214..2881252
Strand-
Gene length (bp)1038
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07766 LETM1_RBD LETM1-like, RBD 1.5E-08 252 312

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 113.22 65.21 161.23
Alive In ants, during behavior modification 36.85 17.68 56.01
Dead In ants, recently dead 43.61 22.67 64.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.404474 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02196
MAMSHRLAWRRCALLGDQGSVRGCAYPALSRPAPLGVIQLSRQLGQSKTIKPGKANPPESTLPPPLEVASRDECE
SKMHYLIQLGKGYVRFYKNGIKAIWTNRKLLRKKLDRMPGSERPSILFPPWDVPATFTRADWVLLWRVRHDLMRL
PIFGLMLLIIGEFTALVVIYVDRVVPYTCRIPKQARNAVERSENRRRDAFRQLQVRYRNGALSPDMTPAVARRHI
LRSLDIAGNMWDRLGFIPPGMWQVKGQSRMKFLEGDDQCLVDEGDSLELSAVELSTACRERGIDTLGKKDSELKA
LLSQWLRLTRADNPAERRRRMAVLMLTRPEEWPQKRDFTVPDWEL*
Coding >Ophcf2|02196
ATGGCCATGAGCCACCGACTCGCCTGGAGGCGCTGTGCGCTACTCGGCGACCAAGGCAGCGTCAGGGGCTGCGCA
TATCCAGCCCTCTCAAGGCCAGCGCCCTTGGGCGTCATACAACTATCGAGACAACTCGGCCAATCCAAAACAATC
AAACCAGGCAAGGCCAATCCGCCAGAGTCCACACTCCCGCCGCCTCTGGAAGTGGCGTCGCGGGACGAGTGCGAG
TCGAAGATGCACTACCTCATCCAGCTGGGCAAGGGCTACGTTCGCTTCTACAAGAACGGGATTAAAGCCATCTGG
ACGAACCGCAAGCTGCTGCGCAAGAAGCTGGACAGAATGCCGGGCAGCGAGCGGCCTTCGATCCTGTTTCCGCCG
TGGGACGTGCCGGCGACGTTTACGCGCGCTGACTGGGTGCTCTTGTGGCGTGTGCGGCATGATCTCATGCGGCTG
CCCATCTTCGGACTCATGCTCCTCATCATCGGCGAGTTCACGGCGCTGGTGGTAATATATGTCGATAGGGTGGTC
CCCTACACGTGCCGGATACCGAAGCAGGCCCGCAACGCGGTGGAGCGGTCCGAGAACCGGCGACGGGACGCCTTT
CGACAGCTTCAAGTACGGTACCGGAACGGCGCGCTCAGCCCCGACATGACGCCGGCCGTGGCCCGGAGACACATC
CTCCGCAGCCTTGACATTGCCGGCAACATGTGGGATCGGCTGGGGTTCATACCGCCGGGCATGTGGCAGGTCAAG
GGCCAGTCGCGCATGAAGTTCCTCGAGGGCGACGACCAGTGTCTCGTCGACGAAGGCGACTCGTTGGAGCTCAGC
GCGGTGGAGCTTTCCACGGCCTGTCGTGAGCGGGGGATCGATACGCTCGGCAAGAAGGACAGCGAACTCAAAGCC
TTACTCTCGCAGTGGCTCCGCCTGACGAGAGCCGATAACCCGGCCGAGAGGCGGCGTCGGATGGCGGTGCTGATG
CTGACCAGGCCAGAAGAGTGGCCGCAGAAGAGGGACTTTACGGTGCCGGACTGGGAGCTGTAG
Transcript >Ophcf2|02196
ATGGCCATGAGCCACCGACTCGCCTGGAGGCGCTGTGCGCTACTCGGCGACCAAGGCAGCGTCAGGGGCTGCGCA
TATCCAGCCCTCTCAAGGCCAGCGCCCTTGGGCGTCATACAACTATCGAGACAACTCGGCCAATCCAAAACAATC
AAACCAGGCAAGGCCAATCCGCCAGAGTCCACACTCCCGCCGCCTCTGGAAGTGGCGTCGCGGGACGAGTGCGAG
TCGAAGATGCACTACCTCATCCAGCTGGGCAAGGGCTACGTTCGCTTCTACAAGAACGGGATTAAAGCCATCTGG
ACGAACCGCAAGCTGCTGCGCAAGAAGCTGGACAGAATGCCGGGCAGCGAGCGGCCTTCGATCCTGTTTCCGCCG
TGGGACGTGCCGGCGACGTTTACGCGCGCTGACTGGGTGCTCTTGTGGCGTGTGCGGCATGATCTCATGCGGCTG
CCCATCTTCGGACTCATGCTCCTCATCATCGGCGAGTTCACGGCGCTGGTGGTAATATATGTCGATAGGGTGGTC
CCCTACACGTGCCGGATACCGAAGCAGGCCCGCAACGCGGTGGAGCGGTCCGAGAACCGGCGACGGGACGCCTTT
CGACAGCTTCAAGTACGGTACCGGAACGGCGCGCTCAGCCCCGACATGACGCCGGCCGTGGCCCGGAGACACATC
CTCCGCAGCCTTGACATTGCCGGCAACATGTGGGATCGGCTGGGGTTCATACCGCCGGGCATGTGGCAGGTCAAG
GGCCAGTCGCGCATGAAGTTCCTCGAGGGCGACGACCAGTGTCTCGTCGACGAAGGCGACTCGTTGGAGCTCAGC
GCGGTGGAGCTTTCCACGGCCTGTCGTGAGCGGGGGATCGATACGCTCGGCAAGAAGGACAGCGAACTCAAAGCC
TTACTCTCGCAGTGGCTCCGCCTGACGAGAGCCGATAACCCGGCCGAGAGGCGGCGTCGGATGGCGGTGCTGATG
CTGACCAGGCCAGAAGAGTGGCCGCAGAAGAGGGACTTTACGGTGCCGGACTGGGAGCTGTAG
Gene >Ophcf2|02196
ATGGCCATGAGCCACCGACTCGCCTGGAGGCGCTGTGCGCTACTCGGCGACCAAGGCAGCGTCAGGGGCTGCGCA
TATCCAGCCCTCTCAAGGCCAGCGCCCTTGGGCGTCATACAACTATCGAGACAACTCGGCCAATCCAAAACAATC
AAACCAGGCAAGGCCAATCCGCCAGAGTCCACACTCCCGCCGCCTCTGGAAGTGGCGTCGCGGGACGAGTGCGAG
TCGAAGATGCACTACCTCATCCAGCTGGGCAAGGGCTACGTTCGCTTCTACAAGAACGGGATTAAAGCCATCTGG
ACGAACCGCAAGCTGCTGCGCAAGAAGCTGGACAGAATGCCGGGCAGCGAGCGGCCTTCGATCCTGTTTCCGCCG
TGGGACGTGCCGGCGACGTTTACGCGCGCTGACTGGGTGCTCTTGTGGCGTGTGCGGCATGATCTCATGCGGCTG
CCCATCTTCGGACTCATGCTCCTCATCATCGGCGAGTTCACGGCGCTGGTGGTAATATATGTCGATAGGGTGGTC
CCCTACACGTGCCGGATACCGAAGCAGGCCCGCAACGCGGTGGAGCGGTCCGAGAACCGGCGACGGGACGCCTTT
CGACAGCTTCAAGTACGGTACCGGAACGGCGCGCTCAGCCCCGACATGACGCCGGCCGTGGCCCGGAGACACATC
CTCCGCAGCCTTGACATTGCCGGCAACATGTGGGATCGGCTGGGGTTCATACCGCCGGGCATGTGGCAGGTCAAG
GGCCAGTCGCGCATGAAGTTCCTCGAGGGCGACGACCAGTGTCTCGTCGACGAAGGCGACTCGTTGGAGCTCAGC
GCGGTGGAGCTTTCCACGGCCTGTCGTGAGCGGGGGATCGATACGCTCGGCAAGAAGGACAGCGAACTCAAAGCC
TTACTCTCGCAGTGGCTCCGCCTGACGAGAGCCGATAACCCGGCCGAGAGGCGGCGTCGGATGGCGGTGCTGATG
CTGACCAGGCCAGAAGAGTGGCCGCAGAAGAGGGACTTTACGGTGCCGGACTGGGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail