Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02188
Gene name
Locationscaffold_02:2861569..2863212
Strand-
Gene length (bp)1643
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00962 A_deaminase Adenosine deaminase 5.4E-24 219 512
PF19326 AMP_deaminase AMP deaminase 3.3E-07 389 512

GO

GO Term Description Terminal node
GO:0032264 IMP salvage Yes
GO:0019239 deaminase activity Yes
GO:0003876 AMP deaminase activity Yes
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0106380 purine ribonucleotide salvage No
GO:0003824 catalytic activity No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0047623 adenosine-phosphate deaminase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0046040 IMP metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0043173 nucleotide salvage No
GO:0044237 cellular metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0043094 cellular metabolic compound salvage No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0009259 ribonucleotide metabolic process No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0043101 purine-containing compound salvage No
GO:0009117 nucleotide metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003674 molecular_function No
GO:0006188 IMP biosynthetic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0032261 purine nucleotide salvage No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6785 0.6597 0.1963 0.0932 0.0711 0.0323 0.046 0.2923 0.1896 0.0496

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1472
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4992
Ophiocordyceps australis map64 (Brazil) OphauB2|2322
Ophiocordyceps camponoti-floridani Ophcf2|02188 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|560
Ophiocordyceps kimflemingae Ophio5|2869
Ophiocordyceps subramaniannii Hirsu2|11058

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02188
MAMADDVWEEISQDIPSASDPFIKQFLAGRSSLVDQEEASRSDASFRNALSPIARKACAIVDAIRRREQETVWSD
GSVFPGMMFMLAKERIENTALWRIVRRMPKGCLLHAHMDAMVDFDFLLDELLSMPGMHMASDVGLCSPAARQEAA
LSFRYRDEECVGESIWDEGYQSGRFLLLTHVAGSFPHGGRRGFLAWLKSRCVLSVEDCHEQHLGIDAIWAKFLRC
FRTVATIIHYEPMFRAFLRRLMQLLMADGVTWVELRFTWGLDYCRDRREEPEKDYSHMFQVLEEEVSRFKGSAEG
KGFWGLRTIWTSMRSSETRQLIENMDHCITTKMEFPHLVAGYDLVGPEDVGKPLVDMLPELFWFRKQCSNEGVNI
PFFFHAGETLGSGSGADANLVDAVLLGTRRIGHGFSLYKHPLLIDMVKEKQILIESCPVSNEVLRLCGSITSHPL
PALLARGVACCLCNDDPAMLGQGTAGMSHDFWQALQGWDNLGLAGLGSLAENSVRWAAFEDQEGGSGRGM*
Coding >Ophcf2|02188
ATGGCCATGGCCGACGACGTCTGGGAGGAAATCTCCCAAGACATTCCCTCCGCGTCTGACCCGTTCATCAAGCAG
TTCCTCGCCGGACGCAGCAGCCTCGTCGACCAGGAAGAGGCATCCCGATCGGACGCGTCGTTTCGAAACGCCCTA
TCGCCCATTGCGCGGAAAGCGTGTGCCATAGTCGACGCCATTCGAAGGCGCGAGCAGGAAACTGTGTGGTCGGAT
GGAAGCGTCTTCCCGGGCATGATGTTCATGCTGGCCAAGGAGCGGATTGAGAATACGGCGCTGTGGCGGATTGTG
CGGCGGATGCCAAAGGGGTGTCTTTTGCACGCCCATATGGATGCCATGGTCGACTTTGACTTTTTGCTTGATGAG
TTGCTGTCTATGCCCGGTATGCACATGGCTAGCGATGTTGGTCTCTGCTCACCTGCTGCCCGTCAGGAGGCTGCG
CTTAGCTTTCGTTATCGAGACGAGGAGTGTGTTGGGGAGTCTATATGGGATGAGGGCTATCAGTCTGGTCGGTTT
CTGCTGCTTACACACGTTGCTGGTTCGTTTCCCCATGGTGGGAGGAGGGGGTTTCTTGCTTGGCTCAAGAGTCGG
TGCGTGCTGTCGGTCGAGGACTGCCATGAGCAGCATCTCGGTATCGACGCCATATGGGCCAAGTTTCTTCGCTGC
TTTAGGACGGTGGCGACTATCATTCACTACGAGCCCATGTTTCGTGCTTTTCTGCGTCGTTTGATGCAGCTGCTC
ATGGCCGACGGCGTCACCTGGGTCGAGTTACGATTTACCTGGGGACTCGACTACTGTCGCGACCGGCGGGAGGAG
CCAGAAAAAGACTACAGTCACATGTTTCAAGTCCTGGAGGAAGAGGTGAGTCGCTTCAAGGGTTCAGCCGAGGGC
AAGGGTTTCTGGGGCCTGAGGACGATATGGACTTCGATGCGCAGCTCGGAGACGAGACAGCTCATCGAGAACATG
GACCACTGCATCACGACTAAGATGGAGTTCCCACACCTCGTGGCTGGCTATGACCTCGTCGGGCCTGAAGATGTT
GGCAAGCCTCTGGTCGATATGCTTCCCGAGCTATTTTGGTTCCGCAAGCAGTGCTCTAACGAGGGCGTCAACATC
CCCTTCTTCTTTCACGCGGGCGAGACGCTCGGGTCCGGGTCCGGGGCAGATGCCAATCTCGTGGACGCGGTGCTA
CTGGGAACGCGACGCATCGGCCACGGCTTCAGCCTGTACAAGCACCCGCTCCTGATCGACATGGTAAAGGAGAAG
CAGATCCTCATCGAATCGTGTCCCGTCTCCAACGAGGTCCTCCGCCTCTGCGGCTCCATCACCTCGCACCCCCTC
CCGGCCCTCCTGGCGCGCGGCGTGGCCTGCTGCCTCTGCAACGACGATCCGGCCATGCTGGGACAGGGCACGGCT
GGGATGTCTCATGATTTCTGGCAGGCGTTGCAGGGGTGGGATAACCTGGGGCTTGCTGGGTTGGGGAGCCTGGCG
GAGAACAGCGTCCGGTGGGCGGCGTTTGAGGATCAGGAGGGGGGGAGTGGGCGAGGGATGTGA
Transcript >Ophcf2|02188
ATGGCCATGGCCGACGACGTCTGGGAGGAAATCTCCCAAGACATTCCCTCCGCGTCTGACCCGTTCATCAAGCAG
TTCCTCGCCGGACGCAGCAGCCTCGTCGACCAGGAAGAGGCATCCCGATCGGACGCGTCGTTTCGAAACGCCCTA
TCGCCCATTGCGCGGAAAGCGTGTGCCATAGTCGACGCCATTCGAAGGCGCGAGCAGGAAACTGTGTGGTCGGAT
GGAAGCGTCTTCCCGGGCATGATGTTCATGCTGGCCAAGGAGCGGATTGAGAATACGGCGCTGTGGCGGATTGTG
CGGCGGATGCCAAAGGGGTGTCTTTTGCACGCCCATATGGATGCCATGGTCGACTTTGACTTTTTGCTTGATGAG
TTGCTGTCTATGCCCGGTATGCACATGGCTAGCGATGTTGGTCTCTGCTCACCTGCTGCCCGTCAGGAGGCTGCG
CTTAGCTTTCGTTATCGAGACGAGGAGTGTGTTGGGGAGTCTATATGGGATGAGGGCTATCAGTCTGGTCGGTTT
CTGCTGCTTACACACGTTGCTGGTTCGTTTCCCCATGGTGGGAGGAGGGGGTTTCTTGCTTGGCTCAAGAGTCGG
TGCGTGCTGTCGGTCGAGGACTGCCATGAGCAGCATCTCGGTATCGACGCCATATGGGCCAAGTTTCTTCGCTGC
TTTAGGACGGTGGCGACTATCATTCACTACGAGCCCATGTTTCGTGCTTTTCTGCGTCGTTTGATGCAGCTGCTC
ATGGCCGACGGCGTCACCTGGGTCGAGTTACGATTTACCTGGGGACTCGACTACTGTCGCGACCGGCGGGAGGAG
CCAGAAAAAGACTACAGTCACATGTTTCAAGTCCTGGAGGAAGAGGTGAGTCGCTTCAAGGGTTCAGCCGAGGGC
AAGGGTTTCTGGGGCCTGAGGACGATATGGACTTCGATGCGCAGCTCGGAGACGAGACAGCTCATCGAGAACATG
GACCACTGCATCACGACTAAGATGGAGTTCCCACACCTCGTGGCTGGCTATGACCTCGTCGGGCCTGAAGATGTT
GGCAAGCCTCTGGTCGATATGCTTCCCGAGCTATTTTGGTTCCGCAAGCAGTGCTCTAACGAGGGCGTCAACATC
CCCTTCTTCTTTCACGCGGGCGAGACGCTCGGGTCCGGGTCCGGGGCAGATGCCAATCTCGTGGACGCGGTGCTA
CTGGGAACGCGACGCATCGGCCACGGCTTCAGCCTGTACAAGCACCCGCTCCTGATCGACATGGTAAAGGAGAAG
CAGATCCTCATCGAATCGTGTCCCGTCTCCAACGAGGTCCTCCGCCTCTGCGGCTCCATCACCTCGCACCCCCTC
CCGGCCCTCCTGGCGCGCGGCGTGGCCTGCTGCCTCTGCAACGACGATCCGGCCATGCTGGGACAGGGCACGGCT
GGGATGTCTCATGATTTCTGGCAGGCGTTGCAGGGGTGGGATAACCTGGGGCTTGCTGGGTTGGGGAGCCTGGCG
GAGAACAGCGTCCGGTGGGCGGCGTTTGAGGATCAGGAGGGGGGGAGTGGGCGAGGGATGTGA
Gene >Ophcf2|02188
ATGGCCATGGCCGACGACGTCTGGGAGGAAATCTCCCAAGACATTCCCTCCGCGTCTGACCCGTTCATCAAGCAG
TTCCTCGCCGGACGCAGCAGCCTCGTCGACCAGGAAGAGGCATCCCGATCGGACGCGTCGTTTCGAAACGCCCTA
TCGCCCATTGCGCGGAAAGCGTGTGCCATAGTCGACGCCATTCGAAGGCGCGAGCAGGAAACTGTGTGGTCGGAT
GGAAGCGTCTTCCCGGGCATGATGTTCATGCTGGCCAAGGAGCGGATTGAGAATACGGCGCTGTGGCGGATTGTG
CGGCGGATGCCAAAGGGGTGTCTTTTGCACGCCCATATGGATGCCATGGTCGACTTTGACTTTTTGCTTGATGAG
TTGCTGTCTATGCCCGGTATGCACATGGCTAGCGATGTTGGTCTCTGCTCACCTGCTGCCCGTCAGGAGGCTGCG
CTTAGCTTTCGTTATCGAGACGAGGAGTGTGTTGGGGAGTCTATATGGGATGAGGGCTATCAGTCTGGTCGGTTT
CTGCTGCTTACACACGTTGCTGGTTCGTTTCCCCATGGTGGGAGGAGGGGGTTTCTTGCTTGGCTCAAGAGTCGG
TGCGTGCTGTCGGTCGAGGACTGCCATGAGCAGCATCTCGGTATCGACGCCATATGGGCCAAGTTTCTTCGCTGC
TTTAGGACGGTGGCGACTATCATTCACTACGAGCCCATGTTTCGTGCTTTTCTGCGTCGTTTGATGCAGCTGCTC
ATGGCCGACGGCGTCACCTGGGTCGAGTTACGGTATTTCACCCTCTTTCACTTTTTTTTATCTTTCTTTATCTGG
ATGATTTCTAACTATGAATATCTGTTTCATGTAAAAGATTTACCTGGGGACTCGACTACTGTCGCGACCGGCGGG
AGGAGCCAGAAAAAGACTACAGTCACATGTTTCAAGTCCTGGAGGAAGAGGTGAGTCGCTTCAAGGGTTCAGCCG
AGGGCAAGGGTTTCTGGGGCCTGAGGACGATATGGACTTCGATGCGCAGCTCGGAGACGAGACAGCTCATCGAGA
ACATGGACCACTGCATCACGACTAAGATGGAGTTCCCACACCTCGTGGCTGGCTATGACCTCGTCGGGCCTGAAG
ATGTTGGCAAGCCTCTGGTCGATATGCTTCCCGAGCTATTTTGGTTCCGCAAGCAGTGCTCTAACGAGGGCGTCA
ACATCCCCTTCTTCTTTCACGCGGGCGAGACGCTCGGGTCCGGGTCCGGGGCAGATGCCAATCTCGTGGACGCGG
TGCTACTGGGAACGCGACGCATCGGCCACGGCTTCAGCCTGTACAAGCACCCGCTCCTGATCGACATGGTAAAGG
AGAAGCAGATCCTCATCGAATCGTGTCCCGTCTCCAACGAGGTCCTCCGCCTCTGCGGCTCCATCACCTCGCACC
CCCTCCCGGCCCTCCTGGCGCGCGGCGTGGCCTGCTGCCTCTGCAACGACGATCCGGCCATGCTGGGACAGGGCA
CGGCTGGGATGTCTCATGATTTCTGGCAGGCGTTGCAGGGGTGGGATAACCTGGGGCTTGCTGGGTTGGGGAGCC
TGGCGGAGAACAGCGTCCGGTGGGCGGCGTTTGAGGATCAGGAGGGGGGGAGTGGGCGAGGGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail