Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02187
Gene name
Locationscaffold_02:2859930..2861190
Strand+
Gene length (bp)1260
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 2.0E-09 40 148

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.672 0.3442 0.1666 0.0605 0.2665 0.0232 0.0325 0.1442 0.1859 0.0256

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4991
Ophiocordyceps australis map64 (Brazil) OphauB2|2321
Ophiocordyceps camponoti-floridani Ophcf2|02187 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|561
Ophiocordyceps kimflemingae Ophio5|2868
Ophiocordyceps subramaniannii Hirsu2|8836

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02187
MMRIVVAGGGGLGYLLATQLSRAANAYSVVVLSRYHRPDFANLDVQIHQISDYNDLNQLAFALQGVDLVISTVSG
RAQLNLIHAAVHGRVRLFVPSEFEGSVARRPSPPHADPLDRGSRQALALLRQSRIRYTVFSCGLFMERFHPCGLA
YLNIGQGASIARPGDYLVDINRATAEFADRDARGRTVRVCLSSVYDVVRFLVAAIDLGTDRWPVEFTMYGDRMSL
NELVDTCSRLRNGDRQTRSVAELQAYAAHHSRAGDSARAAYYHRLLATANGRYDFSHATLNDAIARSDLGEVQPL
TLAQWLYSMLPSP*
Coding >Ophcf2|02187
ATGATGCGCATCGTTGTTGCTGGTGGTGGTGGGCTCGGATACCTGCTGGCGACGCAGCTTTCGCGCGCGGCAAAC
GCCTACAGCGTCGTCGTCTTGTCGAGATATCACCGCCCCGACTTCGCCAACCTCGACGTCCAAATCCACCAAATA
AGCGACTACAACGACCTCAACCAACTCGCCTTCGCCCTCCAAGGCGTCGACCTCGTCATCTCCACCGTCTCAGGC
CGCGCCCAACTCAACCTCATCCACGCCGCCGTCCACGGCCGCGTCCGTCTCTTCGTCCCCTCCGAGTTCGAAGGC
TCCGTCGCTCGACGTCCCTCCCCCCCCCACGCCGATCCCCTCGATCGAGGCTCCCGACAGGCTCTCGCCCTGCTT
CGGCAGTCCCGTATCCGCTATACCGTCTTCTCCTGCGGCTTGTTCATGGAGCGCTTTCATCCCTGTGGCCTCGCC
TATCTCAATATCGGTCAGGGGGCTTCCATCGCTCGTCCGGGCGATTATCTCGTCGACATCAACCGCGCCACCGCA
GAGTTCGCCGATCGAGACGCTCGAGGTCGTACCGTACGAGTCTGTCTCTCTTCCGTCTACGACGTCGTCCGCTTC
CTCGTAGCCGCCATCGATCTCGGAACCGACAGGTGGCCCGTCGAGTTCACCATGTATGGCGACCGCATGTCTCTC
AATGAGCTCGTCGATACCTGCAGTCGCCTCCGTAACGGCGACCGTCAGACCCGCTCCGTCGCCGAGCTCCAGGCC
TACGCCGCTCACCACAGCCGCGCCGGCGATTCCGCTCGAGCCGCCTACTATCACCGCCTGCTGGCCACGGCCAAC
GGTCGCTACGACTTCTCCCATGCCACCCTCAACGACGCCATCGCCCGCAGCGACCTGGGCGAGGTTCAGCCCCTG
ACCCTGGCCCAGTGGCTCTACAGCATGCTGCCGTCGCCGTAG
Transcript >Ophcf2|02187
ATGATGCGCATCGTTGTTGCTGGTGGTGGTGGGCTCGGATACCTGCTGGCGACGCAGCTTTCGCGCGCGGCAAAC
GCCTACAGCGTCGTCGTCTTGTCGAGATATCACCGCCCCGACTTCGCCAACCTCGACGTCCAAATCCACCAAATA
AGCGACTACAACGACCTCAACCAACTCGCCTTCGCCCTCCAAGGCGTCGACCTCGTCATCTCCACCGTCTCAGGC
CGCGCCCAACTCAACCTCATCCACGCCGCCGTCCACGGCCGCGTCCGTCTCTTCGTCCCCTCCGAGTTCGAAGGC
TCCGTCGCTCGACGTCCCTCCCCCCCCCACGCCGATCCCCTCGATCGAGGCTCCCGACAGGCTCTCGCCCTGCTT
CGGCAGTCCCGTATCCGCTATACCGTCTTCTCCTGCGGCTTGTTCATGGAGCGCTTTCATCCCTGTGGCCTCGCC
TATCTCAATATCGGTCAGGGGGCTTCCATCGCTCGTCCGGGCGATTATCTCGTCGACATCAACCGCGCCACCGCA
GAGTTCGCCGATCGAGACGCTCGAGGTCGTACCGTACGAGTCTGTCTCTCTTCCGTCTACGACGTCGTCCGCTTC
CTCGTAGCCGCCATCGATCTCGGAACCGACAGGTGGCCCGTCGAGTTCACCATGTATGGCGACCGCATGTCTCTC
AATGAGCTCGTCGATACCTGCAGTCGCCTCCGTAACGGCGACCGTCAGACCCGCTCCGTCGCCGAGCTCCAGGCC
TACGCCGCTCACCACAGCCGCGCCGGCGATTCCGCTCGAGCCGCCTACTATCACCGCCTGCTGGCCACGGCCAAC
GGTCGCTACGACTTCTCCCATGCCACCCTCAACGACGCCATCGCCCGCAGCGACCTGGGCGAGGTTCAGCCCCTG
ACCCTGGCCCAGTGGCTCTACAGCATGCTGCCGTCGCCGTAG
Gene >Ophcf2|02187
ATGATGCGCATCGTTGTTGCTGGTGGTGGTGGGCTCGGATACCTGCTGGCGACGCAGCTTTCGCGCGCGGCAAAC
GCCTACAGCGTCGTCGTCTTGTCGAGATATGTACGTCTTTGTTTCTGTTGTCCTGGTGTCGAGCTGGATGTGCTG
CTCTCGGCTGTTATCCTTCATCATCATCATCATCACCACTACCACCACTACATCCTCCTCCTCCTGCTCTTCCTC
TTCCTCTCCCTCTTCCTCTTTCTCCTCCTCTCCTCCTCCTCTCCTCCCCTCCCCTCCCCTTTCACTCCCCTCCTC
AAATATTCCCGCCCAAATTAAAAATCCCCCACCAGCACCGCCCCGACTTCGCCAACCTCGACGTCCAAATCCACC
AAATAAGCGACTACAACGACCTCAACCAACTCGCCTTCGCCCTCCAAGGCGTCGACCTCGTCATCTCCACCGTCT
CAGGCCGCGCCCAACTCAACCTCATCCACGCCGCCGTCCACGGCCGCGTCCGTCTCTTCGTCCCCTCCGAGTTCG
AAGGCTCCGTCGCTCGACGTCCCTCCCCCCCCCACGCCGATCCCCTCGATCGAGGCTCCCGACAGGCTCTCGCCC
TGCTTCGGCAGTCCCGTATCCGCTATACCGTCTTCTCCTGCGGCTTGTTCATGGAGCGCTTTCATCCCTGTGGCC
TCGCCTATCTCAATATCGGTCAGGGGGCTTCCATCGCTCGTCCGGGCGATTATCTCGTCGACATCAACCGCGCCA
CCGCAGAGTTCGCCGATCGAGACGCTCGAGGTCGTACCGTACGAGTCTGTCTCTCTTCCGTCTACGACGTCGTCC
GCTTCCTCGTAGCCGCCATCGATCTCGGAACCGACAGGTGGCCCGTCGAGTTCACCATGTATGGCGACCGCATGT
CTCTCAATGAGCTCGTCGATACCTGCAGTCGCCTCCGTAACGGCGAGTCCGAACCCTTCCTTTCTTACTCCCATC
TTCCGTAGTCCCTCTCCGGCTGATGGCCGTCTCGTCTCCTTCATCTCAGTCCACTTCAGCCGTCAGACCCGCTCC
GTCGCCGAGCTCCAGGCCTACGCCGCTCACCACAGCCGCGCCGGCGATTCCGCTCGAGCCGCCTACTATCACCGC
CTGCTGGCCACGGCCAACGGTCGCTACGACTTCTCCCATGCCACCCTCAACGACGCCATCGCCCGCAGCGACCTG
GGCGAGGTTCAGCCCCTGACCCTGGCCCAGTGGCTCTACAGCATGCTGCCGTCGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail