Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02184
Gene name
Locationscaffold_02:2853233..2853790
Strand-
Gene length (bp)557
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 1.2E-15 9 136

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 66 22
3 79 101 22
4 121 143 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 184.28 101.90 266.65
Alive In ants, during behavior modification 43.28 12.96 73.60
Dead In ants, recently dead 50.93 19.75 82.11

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.573199 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02184
MSALDRIVSLLLRAAEVVFAVIVAAVIGYYLHHSQGAGSWSLARFIYTEVVAGLSILLGLLWLLPFARTFSHWPM
DIFISLLWWAAFGVLVNLVGSSCGAIFNWQNVSPTGDQCGRFKAGIAFAFLSAIVWLASALVGLFWTGRHERRVR
NSRV*
Coding >Ophcf2|02184
ATGTCGGCACTCGACCGCATCGTCAGCCTTCTCCTCCGGGCGGCCGAGGTGGTCTTTGCCGTCATCGTCGCCGCC
GTCATTGGCTACTACCTACACCACAGCCAGGGCGCGGGATCGTGGAGCCTGGCGCGTTTCATCTACACCGAGGTG
GTGGCGGGTTTGTCGATCCTGCTGGGCCTGCTATGGCTTCTGCCCTTTGCCAGGACCTTTTCGCACTGGCCGATG
GACATCTTCATCAGTCTGCTGTGGTGGGCGGCCTTTGGGGTCTTGGTGAATCTCGTCGGCTCTTCTTGCGGCGCC
ATCTTCAACTGGCAAAACGTCTCCCCCACCGGCGATCAGTGCGGGCGCTTCAAGGCCGGTATCGCCTTTGCCTTC
CTGTCCGCTATTGTCTGGTTGGCCTCAGCCCTGGTGGGACTGTTCTGGACCGGGCGCCATGAGCGGCGCGTGCGG
AACAGCAGGGTTTAG
Transcript >Ophcf2|02184
ATGTCGGCACTCGACCGCATCGTCAGCCTTCTCCTCCGGGCGGCCGAGGTGGTCTTTGCCGTCATCGTCGCCGCC
GTCATTGGCTACTACCTACACCACAGCCAGGGCGCGGGATCGTGGAGCCTGGCGCGTTTCATCTACACCGAGGTG
GTGGCGGGTTTGTCGATCCTGCTGGGCCTGCTATGGCTTCTGCCCTTTGCCAGGACCTTTTCGCACTGGCCGATG
GACATCTTCATCAGTCTGCTGTGGTGGGCGGCCTTTGGGGTCTTGGTGAATCTCGTCGGCTCTTCTTGCGGCGCC
ATCTTCAACTGGCAAAACGTCTCCCCCACCGGCGATCAGTGCGGGCGCTTCAAGGCCGGTATCGCCTTTGCCTTC
CTGTCCGCTATTGTCTGGTTGGCCTCAGCCCTGGTGGGACTGTTCTGGACCGGGCGCCATGAGCGGCGCGTGCGG
AACAGCAGGGTTTAG
Gene >Ophcf2|02184
ATGTCGGCACTCGACCGCATCGTCAGCCTTCTCCTCCGGGCGGCCGAGGTGGTCTTTGCCGTCATCGTCGCCGCC
GTCATTGGCTACTACCTACACCACAGCCAGGGCGCGGGATCGTGGAGCCTGGCGCGTTTCATCTACACCGAGGTG
GTGGCGGGTTTGTCGATCCTGCTGGGCCTGCTATGGCTTCTGCCCTTTGCCAGGACCTTTTCGCACTGGCCGATG
GACATCTTCATCAGTCTGCTGTGGTGGGCGGCCTTTGGGGTCTTGGTGAATGTCGGTGATGGCTTTCCATTCATT
ATCTTTTGCCTTCTGCGTGCGGATGGTGATGATGACGATGCCGATGCTGACCATGATGCTCCCTACAGCTCGTCG
GCTCTTCTTGCGGCGCCATCTTCAACTGGCAAAACGTCTCCCCCACCGGCGATCAGTGCGGGCGCTTCAAGGCCG
GTATCGCCTTTGCCTTCCTGTCCGCTATTGTCTGGTTGGCCTCAGCCCTGGTGGGACTGTTCTGGACCGGGCGCC
ATGAGCGGCGCGTGCGGAACAGCAGGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail